SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1G272 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1G272
Domain Number 1 Region: 110-279
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-69
Family Thrombospondin C-terminal domain 0.000002
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily TSP type-3 repeat 6.8e-26
Family TSP type-3 repeat 0.0000217
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T1G272
Sequence length 302
Comment (tr|T1G272|T1G272_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO08066.1, ECO:0000313|EnsemblMetazoa:HelroP75607} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_75607 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
DSDHNAVGDECDSEIDRDDDGVIDDIDNCERIYNPDQANNDDDIYGDACDNDDDNDGIID
TEDNCPLVPNKDQMDSDGDGVGDVCKLDSDGDGIFDSEDMCPYNNRISATDFSKLQTINL
DPVGTNQLDPEWVVKNNGSEILQSLNSDPGVALGVHYFGGLDFSGTFFINTEDDDDYAGF
VFGYRNDRRFYVVMWKKEHQTYWKQEPFRAVGDAGVQIKVVHSIEGPGEMMRNSLWHREG
KEDESRNLFNDENKIGWQAKTSYRWELMHRPSIGLIRFRHLFTFLLFYYFLLLLFYWFFV
LI
Download sequence
Identical sequences T1G272
XP_009013855.1.102002 jgi|Helro1|75607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]