SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1G4I8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1G4I8
Domain Number 1 Region: 68-95
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000683
Family EGF-type module 0.026
Further Details:      
 
Weak hits

Sequence:  T1G4I8
Domain Number - Region: 37-61
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000342
Family Integrin beta EGF-like domains 0.044
Further Details:      
 
Domain Number - Region: 158-202
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000807
Family Integrin beta EGF-like domains 0.09
Further Details:      
 
Domain Number - Region: 3-29
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00404
Family EGF-type module 0.064
Further Details:      
 
Domain Number - Region: 97-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00621
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 129-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0137
Family Integrin beta EGF-like domains 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T1G4I8
Sequence length 298
Comment (tr|T1G4I8|T1G4I8_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO01396.1, ECO:0000313|EnsemblMetazoa:HelroP81791} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_81791 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
DCGHNCSNKGDCVGGRCRCQYGFAGRYCQEAACVKECNGRGLHASGHCICNDGWMGSDCG
LQVNTKNQILCRNGGVCYDGRCLCPVGFAGESCSVEVCDPPCVNGYCKDRKCVCFDGYAG
MNCSIRRCDTRCSGIRGTCHDGVCICGAGWYGTHCSMDGCPNACSSRGKCEMISLPPPPS
YSTSCRCDNGWSGSSCNVPVEYQCDDKIDNDQDTLVDCNDPDCCSVSKCMNTILCKSATE
PHNQLRRNEASCSTEAFYERVKFLVDAQNVQLSAHKDVFNDSLVVLLVFVWLVGWLVG
Download sequence
Identical sequences T1G4I8
XP_009020632.1.102002 jgi|Helro1|81791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]