SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1G618 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1G618
Domain Number 1 Region: 112-152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000043
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 2 Region: 35-73
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000947
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 3 Region: 190-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000395
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 4 Region: 153-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000516
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 5 Region: 74-111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000237
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 6 Region: 3-34
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000387
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T1G618
Sequence length 229
Comment (tr|T1G618|T1G618_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESN97211.1, ECO:0000313|EnsemblMetazoa:HelroP85694} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_85694 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
GDDPCLNGGLCIPFFSGGYQCKCPMRFAGEICKNSNSCEKNPCKNGGVCLPLNATDYRCD
CMSTAFVGKNCEYADPCGMNPCLNGGICKSFGSGSYRCDCPSLFSGNQCQTIDVCINNPC
LNGGVCNHSEDNGENFTCSCPDSFFGEHCEYQDFCGSNPCLNGGVCKNLVPGGFRCECSG
SFSGKHCEKTNVCEPNPCFNGGSCFPTNSTDYECHCSGPFRGRNCEIQG
Download sequence
Identical sequences T1G618
jgi|Helro1|85694 XP_009024632.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]