SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1G7L7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1G7L7
Domain Number 1 Region: 177-324
Classification Level Classification E-value
Superfamily PHM/PNGase F 5.75e-38
Family Peptidylglycine alpha-hydroxylating monooxygenase, PHM 0.0000546
Further Details:      
 
Domain Number 2 Region: 46-176
Classification Level Classification E-value
Superfamily PHM/PNGase F 1.83e-30
Family Peptidylglycine alpha-hydroxylating monooxygenase, PHM 0.00018
Further Details:      
 
Domain Number 3 Region: 384-592
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 1.44e-21
Family SGL-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T1G7L7
Sequence length 606
Comment (tr|T1G7L7|T1G7L7_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESN91950.1, ECO:0000313|EnsemblMetazoa:HelroP90150} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_90150 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MAIGLFFNYGCKNICFILTFTIFILLLIIASPLTSSSTPDDGSQPTSWVHTIQMPNVTTD
KEDKYLCIDYDFSIKSKHFLTGFEAKPDNPNVHHMLLFACSGKARSSKAFECLGGCFLER
IYFAWGRNAPPTNLPKGVGFKLATDGIDFLRYQVHYKTIVNTSDQSSLKLTFTTDPQPYT
AAVLLMLKNFLKIPAHTKLTIGNVSCRYNLQATMYPIAFRVHAHMLGRVISAYVKKSSGW
KLIGKGNPQWPQAFWPTNDKELVIENGDFIAAKCVYNSEHYDVDVNIGSTHNDEMCNFYL
MYYKNSSDSGEVNFCDKDEYTDISRDVPGFALEELPPNPDLEDVGEGHKHHHHHVQSNIS
TEAQLNISLKPASNWPMLTNGMELGEVTGLATDRFGFMYLFHRGSTKWMSNSFDENFIYT
GRDQPPIEDNTILKVNISSGEVVKMFGKNIFYMPHGIFVDHEGAIWLTDVAMHNVFKFPT
TLEDNPQASPSLILGEKFIPGLDNVHFCKPTDVVVAPTGEVYVSDGYCNSRVIAFDRFGN
FLKVWRVGEDENTYYLPHSISMDTQTGTIFVASRSSHSLYIYSVAGDFKKKITSDDFIPE
LFSVAY
Download sequence
Identical sequences T1G7L7
XP_009029896.1.102002 jgi|Helro1|90150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]