SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1G811 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1G811
Domain Number 1 Region: 20-136
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.71e-23
Family Synaptotagmin-like (S variant) 0.06
Further Details:      
 
Domain Number 2 Region: 146-262
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.4e-17
Family Synaptotagmin-like (S variant) 0.036
Further Details:      
 
Domain Number 3 Region: 296-476
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000278
Family Integrin A (or I) domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1G811
Sequence length 545
Comment (tr|T1G811|T1G811_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESN89898.1, ECO:0000313|EnsemblMetazoa:HelroP91226} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_91226 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MSSRLANKLTAEPVTKVDIFVSCHNLLNMDTFSKSDPCCVLYIFIAGRWIEHGRTEQIKN
DLNPQFSKNFTVDYFFEEVQKIKFAVYDIDNTTPQLDDDDFLGQTECTLGELVSNSPLVY
PLMKNGMRAGNGTIIVSVEQGKQKDLLLMKFSGSSLDKKDFFGLSDPFLEFNKKMLDGGY
QVVHRTEYIKNTLDPVWKPFQISTSRLCNGNYRESVKVDCYDYNSNSSPDFIGSFETSVE
ELMSAATKPIQWPCVNPKKKAKKSSYKDSGTIHLLSCQISKQFSFLDFVFGGLHLKFCVA
IDFTASNGNPQSPQSLHYLHPQYPNHYVRAIRSVGEVIKDYDSDQLFPCFGFGARIPPHM
EVSHCFPLTFNEAHEHCYGIQGVLEAYYSSLPRLQLYGPTNFTPIIEHIGSLAAIAHNIR
QSYLYYVLLIITDGVISDMSNTVRAIVKNSTLPLSIIIVGVGQAEFDAMDRLDSDDGLLR
DQWGGVAQRDIVQFVPFRNFERASQEALAKQVLAELPDQVVSYYQANKIEPGKPRSDVDE
QKVLL
Download sequence
Identical sequences T1G811
jgi|Helro1|91226 XP_009031981.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]