SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1G8H8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1G8H8
Domain Number 1 Region: 1-81
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-23
Family SH2 domain 0.00048
Further Details:      
 
Domain Number 2 Region: 162-265
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-17
Family SH2 domain 0.0013
Further Details:      
 
Weak hits

Sequence:  T1G8H8
Domain Number - Region: 124-169
Classification Level Classification E-value
Superfamily SH3-domain 0.00038
Family SH3-domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T1G8H8
Sequence length 316
Comment (tr|T1G8H8|T1G8H8_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO04138.1, ECO:0000313|EnsemblMetazoa:HelroP92504} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_92504 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
WYHGRLDRAQAEKRLLEHQKLGSYLIRESDRKPGAYVLSFLGKTGINHFKMTAVCGAYYI
GGREFNSLSLLIGYYTGWSDLLKGERLAHPVPPPERVCEYACVRVSLPTYAHTHMHTNAN
IFNSFMKGEIFMVKNDMGAGWLWVTSTFNNKSGIINQELTEELGDDDDPVEQHKWYHSDI
TSNEVAEKLAKSGQDSWLVKRSEKTKGDFTIYFYCGGSIQKFKVQKQSIGVYFMGGRCFK
SVADVIERYKVEDIIEGHKLTTPVLMVSRCSVAGVCVCLCVFFVCVCVCLCVCEARVCAC
ACVRVRRSYLVDQISD
Download sequence
Identical sequences T1G8H8
XP_009017763.1.102002 jgi|Helro1|92504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]