SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1G8R8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1G8R8
Domain Number 1 Region: 1-140
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.11e-53
Family Thrombospondin C-terminal domain 0.0000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1G8R8
Sequence length 163
Comment (tr|T1G8R8|T1G8R8_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO00747.1, ECO:0000313|EnsemblMetazoa:HelroP93045} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_93045 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
QNDRRFYVVMWKKEHQTYWKQEPFRAVGDAGVQIKVVHSIEGPGEMMRNSLWHREGKEDE
TRNLFNDENKIGWQAKTSYRWELMHRPSIGLIRVKFFNDKRLIVDSGDLFDNTYRGGRVG
LFCFSQSKVIWSDLVTRCNGQYLSVCVSVCVFVRVFVCVFVCE
Download sequence
Identical sequences T1G8R8
jgi|Helro1|93045 XP_009021155.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]