SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1G9I5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1G9I5
Domain Number 1 Region: 66-161,208-456
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.22e-25
Family LacY-like proton/sugar symporter 0.056
Further Details:      
 
Domain Number 2 Region: 484-539
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000305
Family Ovomucoid domain III-like 0.0099
Further Details:      
 
Domain Number 3 Region: 573-681
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00000288
Family Glycerol-3-phosphate transporter 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T1G9I5
Sequence length 700
Comment (tr|T1G9I5|T1G9I5_HELRO) Solute carrier organic anion transporter family member {ECO:0000256|RuleBase:RU362056} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_97665 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence
MLPTNKEPEKLSIVDSLQGHIGNVERFLETSSSAERASNLNFPSQIIVTSFPTTIRLKYG
CFHKFFMKIGTFLCVACCFVALQGMVVSGFVSVCLSTLERRFKFSSTESGIIAMGYDLAS
IICLVPVSFYGGLGHKPRWIAVGALVMGVGSLVFSSPNLLVGPYFYDTRKDPSMLCLDSA
PVNRSGTMEKYECSYQATTSSSIYIVIFMLGHMLHGAGSTPLFTLAVAFIDENVGVKRSP
LYFSIYYSTAMIGPALGYIIGGRLLKTYIDIGRKNSTLNQGDLTPEDPRWLGAWWIGFLV
TGSAFIILSIFLCGFPREMPSRFGNIKFILKIQRKRSSLESVDKKSVDAVHEPADIFHAL
KTLLSNPAFDFITFSGCMEGALVGGFVLFAPKFVEAAFNLSASWSGQLIGIATIPSGSLG
IVIGGIIVKKFHLSAIGSLKFTLVFLGIALLLTLSMLVRCGDILYVGISHPYLDQEVTNS
KINLFSGCNKHCNCSGSMFSPVCGLDGLTYVSPCLAGCQSMKEIKEKNGTWRLFIKCTCV
EDRLEHNNIKTKKPYTLTDDVTASDGTCKNKCNSITFFIIFYSLIIFVSFICWTPVLTAT
LRCVAERHKSLALGLQWMIVRIVGMIPAPMIFGAIIDRACLFWNRDYCFDRTGSCAIYTG
EMMGIYFLSIVITLKTLSFFFILIAAICLKKSKFNSNRNK
Download sequence
Identical sequences T1G9I5
XP_009012688.1.102002 jgi|Helro1|97665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]