SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1GGB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1GGB5
Domain Number 1 Region: 70-112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000181
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 2 Region: 112-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000329
Family EGF-type module 0.006
Further Details:      
 
Domain Number 3 Region: 151-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000823
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 4 Region: 3-45
Classification Level Classification E-value
Superfamily L domain-like 0.00000416
Family Ngr ectodomain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T1GGB5
Sequence length 185
Comment (tr|T1GGB5|T1GGB5_MEGSC) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:MESCA002429-PA} KW=Complete proteome; Reference proteome OX=36166 OS=Megaselia scalaris (Humpbacked fly) (Phora scalaris). GN= OC=Platypezoidea; Phoridae; Megaseliini; Megaselia.
Sequence
EDLKSINNIALGNNPLYCDCSLKWLSDWIKLDYVEHGIARCVEPESMNGKLILSTPSHYF
VCKEKIRHEILSKCNACYTTPCQNNAECVPLPQRDYKCQCQPGYHGRHCEYMIDACYGNP
CRNNATCTVLEEGRFSCQCEPGYSGARCEINIDDCMDNKCQNNATCVDGVQSYTCNCQPG
FSDEI
Download sequence
Identical sequences T1GGB5
MESCA002429-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]