SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1GHP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1GHP9
Domain Number 1 Region: 387-409
Classification Level Classification E-value
Superfamily DPY module 0.00000353
Family DPY module 0.0014
Further Details:      
 
Domain Number 2 Region: 177-200
Classification Level Classification E-value
Superfamily DPY module 0.0000301
Family DPY module 0.0022
Further Details:      
 
Weak hits

Sequence:  T1GHP9
Domain Number - Region: 104-125
Classification Level Classification E-value
Superfamily DPY module 0.000131
Family DPY module 0.003
Further Details:      
 
Domain Number - Region: 280-302
Classification Level Classification E-value
Superfamily DPY module 0.000562
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 301-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.036
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 349-380
Classification Level Classification E-value
Superfamily EGF/Laminin 0.046
Family EGF-type module 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1GHP9
Sequence length 453
Comment (tr|T1GHP9|T1GHP9_MEGSC) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:MESCA002957-PA} KW=Complete proteome; Reference proteome OX=36166 OS=Megaselia scalaris (Humpbacked fly) (Phora scalaris). GN= OC=Platypezoidea; Phoridae; Megaseliini; Megaselia.
Sequence
MELHFVHVDQTILVNLLIVDQNNPCESFCGAFSKCIVKNHIPVCYCIDNYEGNPYLQCSR
KPERTEISHNIQESPCECGVNAYCENNICKCLDNFYGNPNAECKPECVYDNECGFDQKCV
NMKCLQSCSLIECGENANCKVNYHISACVCNENYYGDPYSRICSCLDGYVGSAPACRPEC
LTDNDCSSERTCINEKCVSPCSICAYNADCSVIRHKPICSCPEEMSGNPYSYCWPKPYIK
QEDDVCNPSPCGLFSTCTNNNNVPECKCLENYIGRPPNCRPECTSDFDCISTQHCRNQKC
ENLCSEGICGENAECLAKFHRVSCLCLPGYTGSPYIQCTKPRSEVSFLTPCEKYPCGMNA
KCLNINGREHCVCLENYFGNPYVQCNPECMLNSDCSNNMVCIQQKCQDPCIGLCASNALC
FVRDHIPRCTCQPDFDGNPYELCYPKRQSKVYN
Download sequence
Identical sequences T1GHP9
MESCA002957-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]