SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1GK47 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  T1GK47
Domain Number - Region: 29-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0485
Family Laminin-type module 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1GK47
Sequence length 84
Comment (tr|T1GK47|T1GK47_MEGSC) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:MESCA003862-PA} KW=Complete proteome; Reference proteome OX=36166 OS=Megaselia scalaris (Humpbacked fly) (Phora scalaris). GN= OC=Platypezoidea; Phoridae; Megaseliini; Megaselia.
Sequence
MTPFLECFTNRKLDDFFKILLSNWILWDNCDKACRCKNNSSCDPKTGECICSIGWTGNDC
SEPCPFGTFGAGCKEKCQDIVHVF
Download sequence
Identical sequences T1GK47
MESCA003862-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]