SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1GVQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1GVQ8
Domain Number 1 Region: 78-121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000122
Family EGF-type module 0.013
Further Details:      
 
Domain Number 2 Region: 34-82
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00001
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T1GVQ8
Sequence length 217
Comment (tr|T1GVQ8|T1GVQ8_MEGSC) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:MESCA007874-PA} KW=Complete proteome; Reference proteome OX=36166 OS=Megaselia scalaris (Humpbacked fly) (Phora scalaris). GN= OC=Platypezoidea; Phoridae; Megaseliini; Megaselia.
Sequence
MKRRLQGKHLPLPPTMNGTQWGQATMGKNILKGCISNNMCLNVVCPDPFECNNIWMGYEC
SCGDGRIKSPDGRRCLDRNECLEDKPCMNGGTCINLEPRRRYRCICPDGFWGENCEILQE
EQTNSKIYYSSLAAILVITVLLIVSDGSVNWIPDENDFCGYIYIYRVWMFSDAILMNFNS
DASLWEISFLRNRTVGNAGNGNNEKSIELERLQLQNA
Download sequence
Identical sequences T1GVQ8
MESCA007874-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]