SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1H0J8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1H0J8
Domain Number 1 Region: 317-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000569
Family EGF-type module 0.05
Further Details:      
 
Domain Number 2 Region: 349-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000898
Family EGF-type module 0.048
Further Details:      
 
Weak hits

Sequence:  T1H0J8
Domain Number - Region: 253-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000659
Family EGF-type module 0.087
Further Details:      
 
Domain Number - Region: 282-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00132
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Domain Number - Region: 386-413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00207
Family Integrin beta EGF-like domains 0.046
Further Details:      
 
Domain Number - Region: 5-85
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00889
Family beta-sandwich domain of Sec23/24 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1H0J8
Sequence length 417
Comment (tr|T1H0J8|T1H0J8_MEGSC) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:MESCA009677-PA} KW=Complete proteome; Reference proteome OX=36166 OS=Megaselia scalaris (Humpbacked fly) (Phora scalaris). GN= OC=Platypezoidea; Phoridae; Megaseliini; Megaselia.
Sequence
MPSLPSQPLQQHQQQQQQNQPFQQQLQYYNGQQDESYSAAQQLKWPQVIEIKDFNTLYHA
NIPPYQFWNLELLNKHPTFIRFSFTMPWGGNFAIYGRRNVAASVTQYDFVEFVKGGRIDN
RVKRRRRSTDINVHLNQNVESNIVDAEQQDEIEHDFDGDEIIEEDVSTPLDSGKVIVQRL
NRTHRIAKRSATSSGPITLDNNMETAIVNVTVLQYLDSGKWVISIYNDDLVAHTVTAVTE
EAEGVTTTCPNDCNGRGSCYLGKCDCIDGYQGVDCSKSVCPVLCSAHGHYGGGVCHCEEG
WKGAECDIPQGECEEPNCSNHGRCIDGECRCERGWKGPFCEQHDCIDPACSGHGTCVSGQ
CYCKAGWQGEDCGTIDQQVYQCLPGCSEHGTYDLETGQCVCERHWTGPDCSQDRHKI
Download sequence
Identical sequences T1H0J8
MESCA009677-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]