SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1IU60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1IU60
Domain Number 1 Region: 53-274
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.38e-63
Family Calnexin/calreticulin 0.000000205
Further Details:      
 
Domain Number 2 Region: 263-402
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 5.32e-57
Family P-domain of calnexin/calreticulin 0.000000451
Further Details:      
 
Weak hits

Sequence:  T1IU60
Domain Number - Region: 383-448
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00117
Family Calnexin/calreticulin 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T1IU60
Sequence length 600
Comment (tr|T1IU60|T1IU60_STRMM) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:SMAR004678-PA} KW=Complete proteome; Reference proteome OX=126957 OS=Strigamia maritima (European centipede) (Geophilus maritimus). GN= OC=Pleurostigmophora; Geophilomorpha; Linotaeniidae; Strigamia.
Sequence
MKKLKVWLLLVCLVLKCMADDESAEDISVDDVDIESDGEEMEDSVIMEEINYETPNPSGF
YYFYESFDDKTYFKKRWVISSARKEDTDADIAKYDGKWNLEQAKENALKGDFGLVLKSKA
KHHAIAVSLERTFKFEKKPLIVQYEVQFQDGQECGGGYLKLLSAEKNMKLAEFHDKTPYT
IMFGPDKCGNDHKIHFIFRHKNPINGTITEKHGKASDAKLEEYFKDKKSHLYTLIVKSDN
TFEIFVDQVSVNKGNMLEDVLPPVNPPKEIDDPYDRRPDDWDEREKIPDPNARKPEDWDE
EAPRQLPDPTSVKPEDWMDDEPEMIPDPNAEKPSDWDEEMDGEWEAPLISNPKCEKAGCG
PWKPAMLDNPNYKGKWRAQLIANPNYKGKWKPRKIPNADYFEDDNPFRMTAIDAVGLELW
SMSGNILFDNVIISHDKSVVDALASQTWELKRKKADRESEGLFKRIIIYTNARPWLWAVY
VVVIGLPIVLIFAFCCGSSETEKIRRAAAARAKKTDAATPDSEPETSNPVITTEPVAQET
TPTIEEPEEKETETETEDKNVENIDKEEKEGSEEDAELSGSHDGSGDVGRSPRRRKPRRE
Download sequence
Identical sequences T1IU60
SMAR004678-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]