SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1JEI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1JEI3
Domain Number 1 Region: 354-612
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.44e-64
Family Nuclear receptor ligand-binding domain 0.0000000302
Further Details:      
 
Domain Number 2 Region: 280-359
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.63e-27
Family Nuclear receptor 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1JEI3
Sequence length 618
Comment (tr|T1JEI3|T1JEI3_STRMM) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:SMAR012229-PA} KW=Complete proteome; Reference proteome OX=126957 OS=Strigamia maritima (European centipede) (Geophilus maritimus). GN= OC=Pleurostigmophora; Geophilomorpha; Linotaeniidae; Strigamia.
Sequence
MKLHFSTTDTNKYYFPLQSPAFSTSPTLTFASSDPLTSVSFSLSAFGEEANYSTSPQQPE
VVSSQFHQTEFVDVFPTEFLAGLTASSPSPATTLPSFQETYSPRYRRDSQPEVGVFSYPS
HTPSPPTQVASPPAFVDPFATVAEFYKPAHATSKQPPSATYVPGLTAPAAPSTATFGQAV
FGCAEFPHRFAAPVQSAAQTEFGGLTSAETGFLQGAPSFSSQDLPGPSGVARRPRRPSLT
LQSSDPGVDVQKLRMQSPTTPSTPSSTRSSPTQDKPQSPSQLCAVCGDNAACQHYGVRTC
EGCKGFFKRTVQKGAKYVCLANKDCPVDKRRRNRCQFCRFQKCLVVGMVKEVVRTDNLKG
RRGRLPSKPKSPQESPPSPPVSLITALVRAHVDTTPDLANLDLTHYRECSSGAESPSSEI
EQIQRFYNLLTSSIDVIKTFADKIPGFADLCRDDQDLLFQSASLELFVLRLSYRTKPSDV
TFTFCNGMVLHREQCQRSFGDWLPAINDFSYSLHSMELDISAFACLCALALVTERHGLRD
PKKVELLQMKIIASLRDHVTYNSEAQKKPHYFSHILSKLPELRSLSVQGLQRIFYLKLED
IVPAPSLIENMFVSSLPY
Download sequence
Identical sequences T1JEI3
SMAR012229-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]