SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1KMX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1KMX5
Domain Number 1 Region: 196-232
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000654
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 2 Region: 125-171
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000176
Family LDL receptor-like module 0.0027
Further Details:      
 
Weak hits

Sequence:  T1KMX5
Domain Number - Region: 288-318
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000785
Family LDL receptor-like module 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1KMX5
Sequence length 382
Comment (tr|T1KMX5|T1KMX5_TETUR) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:tetur15g03220.1} KW=Complete proteome; Reference proteome OX=32264 OS=Tetranychus urticae (Two-spotted spider mite). GN= OC=Raphignathae; Tetranychoidea; Tetranychidae; Tetranychus.
Sequence
MNNRLFNKIHRAKHRRLDQLVKIEDIANPRMKITHDEERIRSVSFESTTDTMRYAMHRIA
KNHFRDISILPSSAMMCIFRVSFSYNSAIQSRLRRNHFECFLIHPSVHLQVNSSLFDATQ
NVELDLFLCVDKTKLIFLEYRCDGIPNCPDASDERSCNCPTGQFRASSGYCVSSLIDFVQ
HRYCHSKNNRRACFKVCQPKEFRCSSAKCIPQSKVCDGFADCDYSIDEWHDCQPQEKKIL
KHKCAVDELPCYLKTGIRCAKFYEECFYYHQCEVDGCDPNFSCPKKLDWRCFGGPCVTKK
SLNDDKADCIGGADETPNAARWKKGLKPSIDSKLGVSIEASSAVYKFAKYILSLFLICAI
GVQLYMLKNNSSSRFKRRSSKK
Download sequence
Identical sequences T1KMX5
tetur15g03220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]