SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1PCP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1PCP3
Domain Number 1 Region: 20-141
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.38e-36
Family Cold shock DNA-binding domain-like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1PCP3
Sequence length 143
Comment (tr|T1PCP3|T1PCP3_MUSDO) Ribosomal protein S12 {ECO:0000313|EMBL:AFP60352.1} KW=Complete proteome; Reference proteome OX=7370 OS=Musca domestica (House fly). GN=101893176 OC=Muscoidea; Muscidae; Musca.
Sequence
MGKPRGLRTARKHVNHRRDQRWADKDYKKAHLGTRWKANPFGGASHAKGIVLEKVGVEAK
QPNSAIRKCVRVQLIKNGKKITAFVPRDGSLNYIEENDEVLVAGFGRKGHAVGDIPGVRF
KVVKVANVSLLALYKEKKERPRS
Download sequence
Identical sequences A0A034VDL6 A0A0B4LFD9 A0A0K8W2E3 A0A0L0CBM9 A0A1A9V7N6 A0A1A9WND3 A0A1A9YTC0 A0A1B0AK94 A0A1B0AM46 A0A1B0GC15 A0A1I8PP40 A0A1L8DRZ7 A0A1W4VDQ2 B3MCY5 B3NR75 B4GG48 B4HR27 B4J7M4 B4KRC2 B4LLE1 B4MPQ7 B4P6N7 B4QFE2 Q28XH3 Q8T3U2 T1PCP3
KNC29637 FBpp0140982 FBpp0086701 FBpp0086701 FBpp0086701 FBpp0224098 FBpp0153949 000259585|e3j38X1|2.1.1.373|X:1-143 001436900|e4v6wAX1|2.1.1.373|AX:1-143 DS10_00002493 FBpp0275981 FBpp0250890 7217.FBpp0116089 7222.FBpp0153949 7227.FBpp0086701 7237.FBpp0275981 7244.FBpp0236719 7245.FBpp0257338 7260.FBpp0250890 NP_001286410.1.81976 NP_610939.2.81976 XP_001361764.1.19638 XP_001959478.1.52611 XP_001975664.1.56816 XP_001987305.1.65300 XP_002005403.1.58863 XP_002017629.1.64850 XP_002033811.1.34323 XP_002050700.1.90633 XP_002063110.1.14588 XP_002081467.1.80810 XP_002091277.1.41174 XP_004526424.1.71379 XP_005177095.1.65292 XP_011190839.1.96551 XP_011202136.1.45957 XP_013110683.1.53170 XP_014090729.1.97495 XP_016927815.1.48971 XP_016967727.1.21709 XP_016973583.1.97277 XP_017015179.1.47939 XP_017019686.1.37106 XP_017049992.1.74164 XP_017069525.1.81094 XP_017090216.1.53830 XP_017133200.1.32376 XP_017147934.1.22881 XP_017477359.1.95384 XP_017836073.1.30616 XP_017867553.1.65068 XP_017958799.1.46654 XP_018783554.1.52592 XP_020802377.1.32911 4v6w_AX FBpp0181394 FBpp0257338 FBpp0169669 FBpp0116089 FBpp0201700 FBpp0236719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]