SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T2GGK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T2GGK5
Domain Number 1 Region: 849-997
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.83e-42
Family Toll/Interleukin receptor TIR domain 0.0000826
Further Details:      
 
Domain Number 2 Region: 330-580
Classification Level Classification E-value
Superfamily L domain-like 6.8e-33
Family Internalin LRR domain 0.07
Further Details:      
 
Domain Number 3 Region: 138-327
Classification Level Classification E-value
Superfamily L domain-like 5.65e-29
Family Ngr ectodomain-like 0.023
Further Details:      
 
Domain Number 4 Region: 647-784
Classification Level Classification E-value
Superfamily L domain-like 7.71e-19
Family Ngr ectodomain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T2GGK5
Sequence length 1097
Comment (tr|T2GGK5|T2GGK5_DROME) FI21426p1 {ECO:0000313|EMBL:AGW25617.1} OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=Tl-RB OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSRLKAASELALLVIILQLLQWPGSEASFGRDACSEMSIDGLCQCAPIMSEYEIICPANA
ENPTFRLTIQPKDYVQIMCNLTDTTDYQQLPKKLRIGEVDRVQMRRCMLPGHTPIASILD
YLGIVSPTTLIFESDNLGMNITRQHLDRLHGLKRFRFTTRRLTHIPANLLTDMRNLSHLE
LRANIEEMPSHLFDDLENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLWSNQLHNLTKHD
FEGATSVLGIDIHDNGIEQLPHDVFAHLTNVTDINLSANLFRSLPQGLFDHNKHLNEVRL
MNNRVPLATLPSRLFANQPELQILRLRAELQSLPGDLFEHSTQITNISLGDNLLKTLPAT
LLEHQVNLLSLDLSNNRLTHLPDSLFAHTTNLTDLRLEDNLLTGISGDIFSNLGNLVTLV
MSRNRLRTIDSRAFVSTNGLRHLHLDHNDIDLQQPLLDIMLQTQINSPFGYMHGLLTLNL
RNNSIIFVYNDWKNTMLQLRELDLSYNNISSLGYEDLAFLSQNRLHVNMTHNKIRRIALP
EDVHLGEGYNNNLVHVDLNDNPLVCDCTILWFIQLVRGVHKPQYSRQFKLRTDRLVCSQP
NVLEGTPVRQIEPQTLICPLDFSDDPRERKCPRGCNCHVRTYDKALVINCHSGNLTHVPR
LPNLHKNMQLMELHLENNTLLRLPSANTPGYESVTSLHLAGNNLTSIDVDQLPTNLTHLD
ISWNHLQMLNATVLGFLNRTMKWRSVKLSGNPWMCDCTAKPLLLFTQDNFERIGDRNEMM
CVNAEMPTRMVELSTNDICPAEKGVFIALAVVIALTGLLAGFTAALYYKFQTEIKIWLYA
HNLLLWFVTEEDLDKDKKFDAFISYSHKDQSFIEDYLVPQLEHGPQKFQLCVHERDWLVG
GHIPENIMRSVADSRRTIIVLSQNFIKSEWARLEFRAAHRSALNEGRSRIIVIIYSDIGD
VEKLDEELKAYLKMNTYLKWGDPWFWDKLRFALPHRRPVGNIGNGALIKTALKGSTDDKL
ELIKPSPVTPPLTTPPAEATKNPLVAQLNGVTPHQAIMIANGKNGLTNLYTPNGKSHGNG
HINGAFIINTNAKQSDV
Download sequence
Identical sequences P08953 T2GGK5
FBpp0084431 FBpp0084432 7227.FBpp0084431 FBpp0084431 FBpp0084431 FBpp0303188 NP_524518.1.81976 NP_733166.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]