SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T4BI89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T4BI89
Domain Number 1 Region: 43-218
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.000000000000933
Family Di-heme elbow motif 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T4BI89
Sequence length 232
Comment (tr|T4BI89|T4BI89_CLODI) Putative histamine H3 receptor {ECO:0000313|EMBL:EQI08766.1} KW=Complete proteome OX=1151372 OS=Clostridioides difficile F501. GN=QOE_3484 OC=Peptostreptococcaceae; Clostridioides.
Sequence
MSEEETKVEAATEAPATEGSTTEEAAPKKKGKKWPIVVGVVVVVLIAAGAGFWVWHEQPS
FCAAICHTPMDEYLETYEQEPGTTGVDKWGNEVSNTNAMLAVSHKAQGKDCMSCHVPTLS
EQMSEGINWVTGNYVYPLEERDTDMLTEARGLDGDEFCLNESCHNLTRDDLVKATSGMEF
NPHKAQHGEIECSECHKAHRASVMYCTQCHSEAEVPEGWLTVAEANKLSTAA
Download sequence
Identical sequences A0A096KLD9 C8WLS5 F0HS73 T4BI89
479437.Elen_2585 gi|257792321|ref|YP_003182927.1| WP_009609359.1.14381 WP_009609359.1.74853 WP_009609359.1.87427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]