SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T9EAN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T9EAN1
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily Phage tail protein-like 5.49e-51
Family Lambda phage gpU-like 0.000000778
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T9EAN1
Sequence length 131
Comment (tr|T9EAN1|T9EAN1_ECOLX) Minor tail protein U {ECO:0000313|EMBL:EQY25450.1} KW=Complete proteome OX=1281218 OS=Escherichia coli UMEA 3212-1. GN=G943_01511 OC=Enterobacteriaceae; Escherichia.
Sequence
MKHTDIRAAVLDALEQHEHGATLFDGRPVVFDEEDFPAIAVYLTDAEYTGEELDADTWRA
TLHIEVFLPAQIPDSELDQWMESRIYPAMTAIPALAGLITTMVTQGYEYRRDDDMALWSS
ADLTYSITYEM
Download sequence
Identical sequences T9EAN1
WP_021566322.1.83140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]