SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U3D908 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3D908
Domain Number 1 Region: 371-479
Classification Level Classification E-value
Superfamily Anthrax protective antigen 1.26e-18
Family Anthrax protective antigen 0.013
Further Details:      
 
Domain Number 2 Region: 1829-1909
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000131
Family E-set domains of sugar-utilizing enzymes 0.013
Further Details:      
 
Domain Number 3 Region: 2087-2177
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000476
Family Other IPT/TIG domains 0.034
Further Details:      
 
Domain Number 4 Region: 1239-1318
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000382
Family E-set domains of sugar-utilizing enzymes 0.01
Further Details:      
 
Domain Number 5 Region: 1913-1996
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000406
Family Other IPT/TIG domains 0.012
Further Details:      
 
Domain Number 6 Region: 1157-1234
Classification Level Classification E-value
Superfamily E set domains 0.000000000000043
Family E-set domains of sugar-utilizing enzymes 0.013
Further Details:      
 
Domain Number 7 Region: 1999-2084
Classification Level Classification E-value
Superfamily E set domains 0.000000000000535
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.025
Further Details:      
 
Domain Number 8 Region: 3254-3375,3404-3528
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000288
Family Galacturonase 0.079
Further Details:      
 
Domain Number 9 Region: 1660-1742
Classification Level Classification E-value
Superfamily E set domains 0.00000000000624
Family E-set domains of sugar-utilizing enzymes 0.023
Further Details:      
 
Domain Number 10 Region: 1066-1144
Classification Level Classification E-value
Superfamily E set domains 0.00000000000784
Family E-set domains of sugar-utilizing enzymes 0.029
Further Details:      
 
Domain Number 11 Region: 272-361
Classification Level Classification E-value
Superfamily E set domains 0.0000000000775
Family E-set domains of sugar-utilizing enzymes 0.034
Further Details:      
 
Domain Number 12 Region: 1562-1633
Classification Level Classification E-value
Superfamily E set domains 0.000000000344
Family E-set domains of sugar-utilizing enzymes 0.036
Further Details:      
 
Domain Number 13 Region: 143-241
Classification Level Classification E-value
Superfamily E set domains 0.00000000436
Family E-set domains of sugar-utilizing enzymes 0.025
Further Details:      
 
Domain Number 14 Region: 32-125
Classification Level Classification E-value
Superfamily E set domains 0.00000000751
Family Other IPT/TIG domains 0.088
Further Details:      
 
Domain Number 15 Region: 1330-1387
Classification Level Classification E-value
Superfamily E set domains 0.0000000115
Family E-set domains of sugar-utilizing enzymes 0.024
Further Details:      
 
Domain Number 16 Region: 1747-1822
Classification Level Classification E-value
Superfamily E set domains 0.0000000249
Family Other IPT/TIG domains 0.052
Further Details:      
 
Domain Number 17 Region: 1405-1501
Classification Level Classification E-value
Superfamily Cupredoxins 0.00000144
Family Plastocyanin/azurin-like 0.05
Further Details:      
 
Domain Number 18 Region: 2351-2365,2476-2694
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000527
Family Pectate lyase-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U3D908
Sequence length 4253
Comment (tr|U3D908|U3D908_CALJA) Fibrocystin-L {ECO:0000313|EMBL:JAB09791.1} OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=PKHD1L1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MRHLWLLGIWGLWGLLLCAANPRTDGSEIIPKVTEIIPKYGSINGATRLTIRGEGFSQAN
QFNYGADNAELGNSVQLVSSFQSIACDVEKDASHSTHITCYTRAMPEGSYTVRVSVDGVP
VTENNTCKGHINSWACTFNAKSFRTPTIRSITPLSGTPGTLITIQGRIFTDVYGSNIERS
SNGKNVRILRVYNGGMPCELLIPQSDNLYGLKLDHADGDMGSMICKTTGTFVGHHNASFI
LDSDYGRSLPQKMAYFVSSLSKISMFQTYAEVTTIFPSRGSIQGGTTLTISGRFFDQTDF
PVRVLVGGETCHTLNVTENSICCKTPPKPHILKTVYPGGRGLKLEVWNNSRPVHLEEILE
YNEKTPGYMGASWVDSASYIWPMEQDRFVARFSGFLVAPDSDVYRFYIRGDDRYAIYFSQ
TGLPEDKVRIAYNSANANSYFSSPAQRSDDIYLQKGKEYYIEILLQEYRLSAFVDVGLYQ
YQNVYTEQQTGDAVNEEQVIKSQSTIIQEVQVITLENWETTKAINEVQKIKVTSPCVEAN
SCSLYQYQLIYNMEKTVFLPADASEFILQSALNDLWSIKPDTVQVIRTRNAQSYIYTITF
ISTRGDFDLLGYEVFEGNNVTLDITEQTKGKPNLETFTLNWDGIASRPLTPWSSEAEFQR
AVEEMVSTKCPPQITNFEEGLVVKYFRDYETDFNLEHINRGQKTAETDAYCGRYSLKNPA
VLFDSADVKPNRLPYGDILLFPYNQLCLAYKGFLANYIGLKFQYQDSSKIIRSTDVQFTY
NFAYGNNWTYTCIDLLDLIRTKYTGTNISLQRISLQKASESLSFYVDVVYIGHTSTISTL
DEMPKRRLPALANKGIFLEHFQVNWTKINGPTMTHQYFVTMTSYNCSYNIPMMAVSFGQI
ITYETENEIVYRGNNWPGESKIHIQRIQAASPPLSGSFDIQAYGHILKGLPAGVSAADLQ
FALQSLQGMGRVSVTREGTCAGYTWNIKWRSTCGKQNLLQINDSNIIGEKANMTVTRIKE
GGLFRQHILGDLLRTPSQQPQVEVYVNGIPAKCSGDCGFTWDSAITPLVLGTSPSQGSYD
EGTILTIVGSGFSPGSALTVSVGPVGCYLLSVDEKEIKCQILNGSAGHAPVAVSIADVGL
AQNVGGEEFYFVYQSQISHICPDSGSIAGGTLLTLSGFGFNENSKVLVGNETCNVIEGDL
NRITCRTPKKTEGTVDISVTTNGFQATARDAFSYDCLQTPIITDFSPKVRTVLGEVNLTI
NGYNFGNELTQNVVYVGGKICQILHWNFTDIRCLLPKLPPGKHDIYVEVRNWGFASTRDK
LNSSIQYVLEVTSMFPQRGSLFGGTEIAIRGFGFSTIPAENAVLLGSIPCNVTSSSENVI
KCILHSTGNIFRITNNGKDSVHGLGYAWSPSVLNVSVGDTVAWHWQTHPFLRGIGYRVFS
VSSPGSVIYDGKGFTNGRQKSTSGSFSYQFTSPGIHYYSSGFVDEAHSIFLQGVINVLPA
ETRHIPLHLFVGSSEATYAHGGPENLHLGSSVAGCLATEPLCGLNNTRVKNSDRLLFEVS
SCFSPSISNITPSSGTVNELITIIGHGFSNLPCANKVTIGSYPCVTEESSDDSITCHIDP
QNSMDVGIREIVTLTVYNLGTAINTLSNEFDRRFVLLPNIDLVLPNVGSTTGMTRVTIKG
SGFAVSSAGVEVLMGHFPCKVLSVNYTAIECETSPAGQQLVDVYLLIHGVPALCQGNCTF
SYLESITPYITGISPNSIIESVKVIIEGEGFGTVLDDIALFIGNQQFRAIDVNENNITAL
VTSLPVGRHSLSVVVGSKGLALGNLSVSSPPVASVSPTSGSIGGGTTLVITGNGFYPGNT
TVTIGDDPCQIISINPNEVYCHTPPRTAGMVGVKIFVNTISYPPLLFTYALEDTPFLRGI
VPSRGPPGTEIEITGSNFGIEILDISVMINNIQCNVTMANDSVLQCIVGDHAGGTFPVMM
HHKTKGSAISTVVFEYPLHIQSINPSQGSFGGGQTMTVTGTGFNPQNSIILICGTECAVD
RLRSDYTTLLCEIPSNNGRGAEQTCEVSVVNGKDLSQSTTPFTYALFLTPLITAVSPKRG
STAGGTRLTVMGSGFSENIEDVHITIAEAKCAIECSNKTHIICMTDAYPLSGWAPVHVHI
RGVGMAKLDNGDFLYVDAWSSNFSWGGRSPPEEGSLVVITKGQTILLDQSTPILKMLLIQ
GGTLIFDEADIELQAENILITDGGILQIGTEASPFQHKAVITLHGHLRSPELPVYGAKTL
AVREGILDLHGVPVPVIWTCLAHTAKAGERILILQEAVTWKPGDNIVIASTGHRHSQGEN
EKRTIASVSADGITITLSNPLNYTHLGITVTLPDGTLFEARAEVGILTRNILIRGSDNVE
WNNKIPACPDGFDTGEFATQTCLQGKFGEEIGSDQFGGCIMFHAPVPGANMVTGRIEYVE
VFHAGQAFRLGRYPIHWHLLGDLHFKSYVRGCAIHQAYNRAVTIHNTHHLLVERNIIYDI
RGGAFFIEDGIEHGNILQYNLAVFVQQSTSLLNDDVTPAAFWVTNPNNTVRHNAVAGGTH
FGFWYRMNNHPDGPSYDRNICQKRVPLGEFFNNTVHSQGWFGMWIFEDYFPMQTGSCTST
VPMPARFNSFTAWNCQKGAEWVNGGALQFHNFVMVNNYEAGIETKRILAPYVGGWGETNG
AIIKNAKIVGHLDELGMGSAFCTRKGLVLPFSEGLTVSSVHFMNFDHPNCVALGVTSISG
VCNDRCGGWSAKFVDIQYFHTPNKAGFRWEHEMVLIDVDGSLTGHKGHTVIPHSSLLDPS
HCTQEPEWSIGFPGSVCDASVSFHRLAFNKPSPASLLEKDVVLSDSFGTSIIPFQKKRLT
HMSGWMALIPNANHINWYFKGVDHITNISYTSTFYGFKDEDYVIISHNFTQNPDMFNIID
IRNGSSNPLNWDTSKNGDWHLEANTSTLYYLVSGRNDLQQSQPISANLDPDVKDVVINFQ
AYCCILQECFTVYPPSRKPMPKRRPATYNLWSNDSFWQSSRENNYTVPHPGANVIIPEGI
WIVADIDMPSMERLIIWGVLELEDKYNVGAAESSYREVVLNATYISLQGGRLIGGWEDNP
FKGDLKIVLRGNHTTRDWALPEGPNQGSKVLGVFGELDLHGIPRSIYKTKLSETADAGSK
ILSLMDAVDWQEGEEIVITTTSYDFHQTETRSIVKILHDRKILILNDSLSYTHFAEKYHV
PGTGESYTLAADVGILSRNIKIVGEDYPGWYQDSFGAHVLVGSFTENMMTFKGNARISNV
EFYHCGQEGFRGSTDPRYAVTFLNLGQIQEHGSSYIQGCAFHHGFSPAIGVFGTDGLDID
DNIIHFTVGEGIRIWGNANRVRGNLIALSVWPGTYQNRKDFSSTLWHAAIEINGGTNTVL
QNNVVAGFARAGYRIDGEPCPSQFNPVEKWFDNEAHGGLYGIYMNQDGLPGCSLIQGFTI
WTCWDYGIYFQTTENVHIYNVTLVDNGMAIFPMIYLPAAISHKISNKKVQIKSSLIVGSS
PGFNCSDILTNDDPNVELTAADRSPRSPSGGRSGICWPTFASAHNMAPRKPHAGIMSYNA
INGLLDVSGSTFVGFKNVCSGETNVIFITNPLNEDLQHPIHVKNIKLVDTTEQSKIFIHR
PDISKVNPSDCVDMVCDAKRKSFLRDIDGSFLGNAGFVIPQAEYEWDGKSQLGIGDYRIP
KVMLTFLNGSKIPVTEKAPHKGIIRDSTCTYIPQWQSYQCFGMEYALMVIESLDPDTETR
RISPVAIVGNGYVDLINGPQDHGWCAGYTCQRRLSLFHSIVALNKSYEIYFTGTSPQNLR
LMLLNVDHNKAVLVGIFFSTLQRLDVYVNNSLVCPKNTIWNAQQKHCELNTLLYKDQFLP
NLASTVLGENYFDRTYQLLYLLVKGAIPVEIHTATVIFVSFQLPAVTEDDFYTSQNLVRN
LAFFLKIPSDKIRISKMIREKSLRRKRSIGFIIEIEIGDPPIQFLNNGTTGQMQLSELQE
IAGSLGQAVILGKISSILGFNISSMSITNPLPSPSDSGWIKVTAQPVERSAFPVHHVAFV
SSLSVITQPVAAQPGQPFPQQPSVKATDSDGNCVSVGITALTLRAILKDSNNNQVSGLSG
NTTIPFSSCWANYTDLTPLRTGKNYKIEFILDNVVRVESRTFSLQAESVSSSSGSSSSSS
SSGGGSSSNSKASTVGTSAQIMTAVISCLIGRMWLLEIFMAAVSTVNITLRSY
Download sequence
Identical sequences U3D908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]