SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U3I427 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3I427
Domain Number 1 Region: 49-84
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 2 Region: 95-127
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000223
Family LDL receptor-like module 0.0044
Further Details:      
 
Weak hits

Sequence:  U3I427
Domain Number - Region: 134-175
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0114
Family LDL receptor-like module 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U3I427
Sequence length 176
Comment (tr|U3I427|U3I427_ANAPL) Low density lipoprotein receptor class A domain containing 1 {ECO:0000313|Ensembl:ENSAPLP00000001998} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=LDLRAD1 OC=Anatinae; Anas.
Sequence
GAPLCCPPRCVCVTSLLLLAATVAIVGLAVALGLPPRSPANRLCAASNNRTGFLCDDRVT
CIPASQVCDRTSNCRDGEDEQEELCGDLPRSLPTYLFFRCGNPAHWVYADKRCNGINDCG
DCSDEIGSLSACPPCGSAWWSCSPVFHEYCACVPRSLCRDSVQHCTSWSDEYLCTP
Download sequence
Identical sequences U3I427
ENSAPLP00000001998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]