SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U3I736 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3I736
Domain Number 1 Region: 438-657
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000234
Family Clathrin heavy-chain linker domain 0.096
Further Details:      
 
Domain Number 2 Region: 5-151
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000397
Family APC10-like 0.032
Further Details:      
 
Weak hits

Sequence:  U3I736
Domain Number - Region: 697-746
Classification Level Classification E-value
Superfamily Prefoldin 0.0131
Family Prefoldin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U3I736
Sequence length 947
Comment (tr|U3I736|U3I736_ANAPL) Centrosomal protein 104 {ECO:0000313|Ensembl:ENSAPLP00000003057} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=CEP104 OC=Anatinae; Anas.
Sequence
MPHKIGFIVVSSSGHEDGFSAKELMVHAPTVNGWRSPRLCQYPQEIVLQLVERCRIRKLQ
LLAHQYMISSKIEFYISESLPEYFAPYQSERFHRLGYVPLSDNEKTGFKARELKSVYMDA
VGQYLKLIFHKNYVNKYNLYSQVALVAINIIGDPADYSHDSNNNPSREKLIDHYLGSKSD
DPALDGTYLGKSDFISPLDDLAFDMYQDPEVAQIIRRLDEKKREAVHHERYDYAKKLKQA
IADLQKVGERLGRYEVEKRYAVEKEDYDLAKKKKQQMEAYRLKVYQQLQLHNLLDAELMI
RKPAELPLESMIYANIKATNSPSCEQIEPEKEEVWNAESLLEEKAGQPASPEPIFAHQSS
PPAVAHPTTSREAFPKENVEFLPYDERPLPAVRKHSEEAITYLEPEMTEGDINNPPRSGI
PGEPEPLTEKALREASPAIEVFGEALVSGAYSKTWSYREDALLAVYQKLMEMSVSTPKED
LKNMMRAAIFLVRRAIKDIVSSVFQASLKLLKMIVTQYIPKHKLGKQETSHCVEKTLPSL
LSRTGDSSSRLRLVASNFIQEMALCSEVKPLQIVPVHLVQPLKPNSPIHLAMSQVELVEC
LLKDMGTENSGFTISNVMKFATGALEHRVYEVRDVALRIIFDMYRKHKAAILEYLPPDDA
SIRKTVLYKTLFDGFAKIDGKLSDAEIRAQKKAATEEAEKQKKEEIKVLQDQLAALKEIQ
AEVQAGKEMESDFQKPKDQGYPVNRSPQSAAAEIPDDHSSVANYLDNLCIFCGERDESFT
DEGLDLHYWKHCPMLTRCEHCRQVVEIASLTEHLLTECDKKDSFGKCQRCSEALPKDELP
KHIKSKICNAAKPEQVANHCPLCHDNFAPGEEAWKSHLMGKDGCKMNPRRLPTINKTLLV
QPGKIGGHYLRKPDPSGAKARPPSMGSKIPTPRGGPNKGTGKTYSKR
Download sequence
Identical sequences U3I736
ENSAPLP00000003057 XP_005011080.1.99704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]