SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U3IPY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3IPY9
Domain Number 1 Region: 1-110
Classification Level Classification E-value
Superfamily SH2 domain 7.54e-24
Family SH2 domain 0.00076
Further Details:      
 
Domain Number 2 Region: 113-143
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000157
Family SOCS box-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U3IPY9
Sequence length 145
Comment (tr|U3IPY9|U3IPY9_ANAPL) Uncharacterized protein {ECO:0000313|Ensembl:ENSAPLP00000009312} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN= OC=Anatinae; Anas.
Sequence
GWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSL
WCHPKFEDRCQSVVEFIKRAIMHSKNAAFPPPVSGLPPTPVQLLYPVSRFSNVKSLQHLC
RFRIRQLVRIDHIPELPLPKVLRIL
Download sequence
Identical sequences U3IPY9
ENSAPLP00000009312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]