SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U3J2J7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3J2J7
Domain Number 1 Region: 1112-1289
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.42e-37
Family BCR-homology GTPase activation domain (BH-domain) 0.00063
Further Details:      
 
Domain Number 2 Region: 674-788
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.45e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.002
Further Details:      
 
Domain Number 3 Region: 434-560
Classification Level Classification E-value
Superfamily PH domain-like 2.68e-23
Family Pleckstrin-homology domain (PH domain) 0.0000263
Further Details:      
 
Domain Number 4 Region: 882-1026
Classification Level Classification E-value
Superfamily PH domain-like 9.59e-19
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 5 Region: 1421-1528
Classification Level Classification E-value
Superfamily PH domain-like 1.42e-16
Family Pleckstrin-homology domain (PH domain) 0.052
Further Details:      
 
Domain Number 6 Region: 576-689
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000184
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Domain Number 7 Region: 7-69
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000101
Family SAM (sterile alpha motif) domain 0.00042
Further Details:      
 
Domain Number 8 Region: 1003-1104
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000147
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Weak hits

Sequence:  U3J2J7
Domain Number - Region: 1320-1405
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0196
Family Ras-binding domain, RBD 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U3J2J7
Sequence length 1683
Comment (tr|U3J2J7|U3J2J7_ANAPL) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 {ECO:0000313|Ensembl:ENSAPLP00000013724} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=ARAP2 OC=Anatinae; Anas.
Sequence
MSSTGNDTDIEEFLVNINLGQYLPNFKEYGYNIVTDCTGINNSVLQQMGVLPTGHRRRIL
KQLDTALSKRQGHLLNENVKLKDSTGLEKKQYLCVDEDSPVSNLNAGETDLIPATSSVQL
PNEAYFGEERFKLGEQNLSEASDDSITNLDFSGLYQNSDSIVKAVSLSGSIKMNAQPDTS
LEEAAAYQTDEHLAGRLAFCDPPSSFAHSCETKYSENKHLMLADEDDLSDCEPSSPFFKF
QGEMINNDLYDSCTQNSTTVFPRASRSFMLRHRPVPEIPESSKGIPGGRNRREKKKTKSS
GKIMSMQSYREEKPPIISPYGETFFWDNLQDAKTRGKNSEFKPLEKLTAGENGAATYLCT
IPDSCRSSHNQDEKTKECAKKPVSQENKSLAPEDFESESVYSVVDQCSLPLKKKKNKAKS
HSSCSKNRSEDANHLISEQMDFRQFDGAQISIANESITPYACFYGPSVKKLKAGWLDKLS
PQGKRMFQKRWVKFDGDSISYYNNEKEVFSKGIILLSAIATVRVHGENKFEVVTSHRTFV
FRVDKEEERNDWVNTILNALKSQSDNHSQSRTSVAPEKSGYLELKGYKAKIFVLLQGNTV
WICKNEQDFKTGFGITLIPMNVANVKQVDRTAKQSFEIITPYKSFSFTAESEREKQDWIE
ALQQSIAETLSDYEVAEKIWFNESNRSCADCKAPNPDWASINLCVVICKKCAGQHRSLGP
RDSKVRSLKMDASIWSNELIELFIIIGNKRANSFWAGNLPPDEELHMDAPAEKRIAFITQ
KYKEGKFRKAPFLYKTKEQLNKALCAAVVKQDVLETLMLLFSGADVMCATGDPVYSTPYL
LAKKAGQRLQMEFLYHNKFSDFPSYDICLESGFSEDSSHSTFLCEFLYKVSSNTTKLLTE
KKLKEDCNKRWCTLESGFLSYYENDKTTTPNGMLDISEVICLVVHKSDFFLNRGDVFTFE
IYLMSERVFLFGAETAYSQRKWTWAIAKHFVPPVAECLLERDCDLIGQLYYKDCHSLDQW
RKGWFAIEKSSLYFCLEMENAQEDSIYLRRLQELTISSVMQNGEKIDVLLLVEKGRTLYI
HGHTKLDFMVWYTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVTQYGLGSKQIYLK
NGNSSNVAELLESFKKDARSVKLRAGKHQLEDVTDVLKSFLSQIDDALLTKELYPFWISA
LADMQNEKERVRKYGAFIRTLPPVNKATLAALIEHLYSRVQKCSEINHMNPHNLAMVFSS
CLFQTKGQTSEEVNVIEDLIKNYVQLFDINEDQVKQMDIENSFITRWKDTQVSQAGDLLI
EVYVERKEPDCSIIIRVSPLTEAEELTNDVLGIKNITPNKDDIWAAFEVLENGELERPLH
YTENVLEQVLHWSSLPEPGTAYLIIKRFLTTDMMKLYSEKNVKGSVKAGYLKYKEEPSKL
LSGNKFQERYFVLREGNLLLYKDMKASKPEKVLPVNSLKLYLGVKKKMKPPTNWGIAVFS
EKHQWHICCDGQDTQMEWMISIFTAQHADIWPPAGKARKQSITKSPKIGGLPLIPIQQEN
TTCKIRGSIENIQLGLGKPKLSDHNEDDLLEERKNLKEKASIVAQCLERKEEKVRNHAKA
HRSFISEDIGVGKTDLCQRPHKPLKKNKNKTNKTALELDKKLPSNVIQELNTVLQKNRAL
HDE
Download sequence
Identical sequences U3J2J7
ENSAPLP00000013724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]