SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U3J758 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3J758
Domain Number 1 Region: 125-208
Classification Level Classification E-value
Superfamily E set domains 3.92e-20
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U3J758
Sequence length 454
Comment (tr|U3J758|U3J758_ANAPL) Early B-cell factor 1 {ECO:0000313|Ensembl:ENSAPLP00000015335} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=EBF1 OC=Anatinae; Anas.
Sequence
AIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQN
CLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEGTPSYL
EHATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPR
HIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEV
ILKRAADLVEALYGMPHNNQEIILKRAADIAEALYSVPRNHNQLPALANTSVHAGMMGVN
SFSGQLAVNVSEASQATNQGFTRNSSSVSPHGYVPSTTPQQTNYNSVTTSMNGYGNAGMS
NLGGSPTFLNGSAANSPYAIVPSSPTMASSTSLPSNCSSSSGIFSFSPANMVSAVKQKSA
FAPVVRPQTSPPPTCTSTNGNSLQAISGMIVPPM
Download sequence
Identical sequences A0A091EFU3 A0A091V5K2 A0A093HVM5 A0A0A0A162 G1N055 U3J758
ENSAPLP00000015335 ENSMGAP00000004755 ENSMGAP00000004755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]