SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U3JF55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3JF55
Domain Number 1 Region: 213-332
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.28e-46
Family MBT repeat 0.0000459
Further Details:      
 
Domain Number 2 Region: 101-210
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 8.28e-44
Family MBT repeat 0.00000398
Further Details:      
 
Domain Number 3 Region: 317-443
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 8.27e-36
Family MBT repeat 0.0000284
Further Details:      
 
Domain Number 4 Region: 574-647
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.63e-16
Family SAM (sterile alpha motif) domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U3JF55
Sequence length 651
Comment (tr|U3JF55|U3JF55_FICAL) Uncharacterized protein {ECO:0000313|Ensembl:ENSFALP00000001409} KW=Complete proteome; Reference proteome OX=59894 OS=Ficedula albicollis (Collared flycatcher) (Muscicapa albicollis). GN= OC=Ficedula.
Sequence
MGSQQHRESSGCQVTEAGRPVRRLRRKRRLPLDSEDEEENVYEDESANWAEEKNKSNNMK
SRRNTKPIKQVLPGKKRVWNWSSYLEEEQMPAAPQKLFREYQSFPQGRNGFKVGMKLEGV
DPEHPSRFCVLTVAEVQGYRMRLHFDGYPECYDFWANADSSDIHPVGWCEKTSHKLLPPK
GFKEGEFNWTSYLKNCKAQAAPKSLFKTLSSPVTPSGFRLGMKLEAVDKKNPSLLCVATI
TDVVENRLLIHFDNWDDSYDYWCETSSPYIRPVGYCQETGTPLTTPPGHKDSKAFSWEKY
LEETNSQAAPARAFKLRPPHGFQVNTKLEAVDRRNPILIRVATIVDKDNHRVKIHFDGWD
HHYDFWVDADSPDIHPVGWCDKTGHALQVPLGAEDPEGAVGQACPTPGCQGIGHVRGPRY
GTHYTLVGCPYSDVNLSRENLLQDRLSGERPSPGSSMQKARRLETADPLLGAEESSQGDS
AQSSISFPDSRRKSAPDSEKWCQSSIHTPSEQLGCSHAYIKFQLVKQESNGKGPDLDLQQ
ALHQSIFMPSLASNPTHRLHLFWEQHCRLLPEVSGLTAKQVAKWTVEEVVSFIQRLPGCK
EQASVFREEQIDGEAFLLLKQNDIVKILSIKLGPALKIYNAILMFKSAEDN
Download sequence
Identical sequences U3JF55
ENSFALP00000001409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]