SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U3JHX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3JHX6
Domain Number 1 Region: 585-806
Classification Level Classification E-value
Superfamily Ras GEF 3.79e-33
Family Ras GEF 0.0062
Further Details:      
 
Domain Number 2 Region: 211-327
Classification Level Classification E-value
Superfamily SH2 domain 1.35e-25
Family SH2 domain 0.00053
Further Details:      
 
Domain Number 3 Region: 4-63
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000147
Family SAM (sterile alpha motif) domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U3JHX6
Sequence length 895
Comment (tr|U3JHX6|U3JHX6_FICAL) Breast cancer anti-estrogen resistance 3 {ECO:0000313|Ensembl:ENSFALP00000002380} KW=Complete proteome; Reference proteome OX=59894 OS=Ficedula albicollis (Collared flycatcher) (Muscicapa albicollis). GN=BCAR3 OC=Ficedula.
Sequence
MKYLPISNWLTQLGLAEYCTLFEQYDGIEDLFHLTEVDLRKLGIENQGHRTHLISNILLL
QEVKQKREPKMIAAGKLSSLPRSSPVNHQFSLASSMDLLTTKPSTIEHRSNSFQGISIHG
TLPRKKKGTVPSRSCDMFSHMGTLPYIRARQQPPLIQDIIEEYPPENGKGSKLLDRDQNI
LDPALEYVKFSRERQVMDNSPEKLKKELEEELQLSSEDLRSHAWYHGRIPRQVAEGLVQR
DGDFLIRDSLSSPGNFVLTCQWKNTPQHFKINKTVLRLNEAYCRVQYQFELESFDTVPGL
VRYYVGNRTPISKQSGAIIFQPINRTVPLRCLEEKYGVTPVQQKEPSTPEGKTETAKGLS
PGISSMQSPEQSIPRGNLWRNKEKSGSQPASLDHVLEKRFPLKAHQSESYLLIGSRHPSR
LPEADANSCPSSPAFRTGSEPSLSPTVVQKVILESQLGEALRGSDSQLCLKPPPKPCKAP
LIKPPDSPLASHSSEGHYCELNPARHPTAAKQHLCQKNSYVEHLTQKERATFRNSETSYL
ILDDDPTTSPADPSEASTQMAEEDSIFSAPVYEKVSSFKPNDFESKLLPPENKPLETSML
RRVKELFTNNNPKMIAQHILRMDCKVARIVEVSEEMRRNMGGNSGLELITLPYGHQLRLD
LIERHNTMAIGIAVDILGCTGNVEERAATLNRIIQVAVELKESLGDLYGFSAIMKALEMP
QVSRLEQTWTALRHCYTQTAIMYEKQLKPSCKALHEGQDEWTKTISAPQNNITVPLLMPL
VTLLERQAVVFEGVELWESSDQSGEIMLRHLGTARLLAQHAETFRLTAERLLQGFQPDEE
LSEIFKTEFQMRLLWGSKGAQVNQSERYEKFNRILTALSRKLEPPPVKLVEQLSI
Download sequence
Identical sequences U3JHX6
XP_005050432.1.66865 XP_005050433.1.66865 ENSFALP00000002380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]