SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U3JJA8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3JJA8
Domain Number 1 Region: 254-306
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000123
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 2 Region: 896-948
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000476
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 389-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000842
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 4 Region: 732-778
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000924
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 5 Region: 953-1002
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000159
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 863-904
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000294
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 7 Region: 770-828
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000643
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Weak hits

Sequence:  U3JJA8
Domain Number - Region: 296-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000159
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number - Region: 431-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00672
Family Classic zinc finger, C2H2 0.047
Further Details:      
 
Domain Number - Region: 2-23,100-125
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0399
Family Classic zinc finger, C2H2 0.04
Further Details:      
 
Domain Number - Region: 340-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0819
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U3JJA8
Sequence length 1232
Comment (tr|U3JJA8|U3JJA8_FICAL) Zinc finger and AT-hook domain containing {ECO:0000313|Ensembl:ENSFALP00000002862} KW=Complete proteome; Reference proteome OX=59894 OS=Ficedula albicollis (Collared flycatcher) (Muscicapa albicollis). GN=ZFAT OC=Ficedula.
Sequence
MCKLCNLFSPNKSELLSHVSEKHTEEGTSVDDIIIPLQPLTVPTNTSKDGEELLVAKRKR
GRPKGSTKKFCVDEDVAENNPVPSKEAPAGTEEGPEPSEVSPGSLECRKCNRKFSNTRQL
TKHICIIVLNEGEEEGDGGNDSDVDLDRKEDEREKTPKRPRVQKTEKTASTKETEQVSGA
KNPIISVVLTAHETIPGARKIVPLEASPHESEPTAADTAVQDPSQRKGYQEYAIQQTPYE
QAMKTSRLGPTQLKIFTCEYCNKVFKFKHSLQAHLRIHTNEKPYKCSYCSYASAIKANLN
VHLRKHTGEKFSCDFCTFTCLSKGHLKVHIERVHKKIKQHCRFCKKKYSDVKNLIKHMKE
THDLQDKKVKDVFDELRLMTREGKRQLLYDCHICERKFKNELDRDRHMLVHGDERPFACE
LCGHGATKYQALELHVRKHPFVYVCSVCLKKFVSSVRLRAHIKDVHADLQEDSVFNSSIN
QSFCLLEPGGDIQPEALGEQQTQTAGESTVTSTDAINAPQPSASEGESAAAEVNHDGQHN
GAGKIDAVLSLELENPVVKNVAETLCQTADVAVPDIQPCVASDCFLLKNGTAGPEELKAS
PPNEEEVNHCSPVNEQGEEIHLLLSEDKSLNVTLNNAMTESLPVLEERIQSVPPGESETS
NPPIQNSAEPTDPLAAAEAGAATSPQAASSNTATANGGNGSFAFMQILDSLQKRQMSTEL
RERIRKVYGDLECEYCGKLFWYQVHYDMHVRTHTREHLYYCSQCNYSSITKNCLKRHVIQ
KHSNILLKCPTEHCEYSTPDKYKLQAHLKVHTDLDKKSYSCPVCEKSFSEDRLIKSHIKT
NHPEVSMTTISEILGRRVQLKGLIGKRAVKCPHCDFYFMKNGSDLQRHIWAHEGVKPFKC
SLCEYATRSKSNLKAHMNRHSTEKTHLCDMCGKKFKSKGTLKSHKLLHTADGKQFKCTVC
DYTAAQKPQLLRHMEQHVSFKPFRCAHCHYSCNISGSLKRHYNRKHPNEEYVNAGSGEPA
AEALIQQGGIKCPVCSFVYGTKWEFNRHLKNKHGMKLVENDGETKWELTAEVSEEASTQY
LHITEAGEDVQGTQAAVAALQNLRYTSENSERLDPTAVNILQQIIELGSESHDATAVASV
VTMAPGTVTVVKQVKEEEQAANHTLMIQETLQQASVELSEQHHLVVSSDEVEGIETVTVY
TQGGEASEFIVYVQEAVQPVEEQTVEESVQEI
Download sequence
Identical sequences U3JJA8
ENSFALP00000002862 XP_005042558.1.66865 XP_005042559.1.66865 XP_016152378.1.66865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]