SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U3JK71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3JK71
Domain Number 1 Region: 11-242
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.66e-79
Family BAR domain 0.00000000228
Further Details:      
 
Domain Number 2 Region: 285-349
Classification Level Classification E-value
Superfamily SH3-domain 1.02e-22
Family SH3-domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U3JK71
Sequence length 352
Comment (tr|U3JK71|U3JK71_FICAL) SH3 domain containing GRB2 like 2, endophilin A1 {ECO:0000313|Ensembl:ENSFALP00000003175} KW=Complete proteome; Reference proteome OX=59894 OS=Ficedula albicollis (Collared flycatcher) (Muscicapa albicollis). GN=SH3GL2 OC=Ficedula.
Sequence
MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMAKTIEYLQP
NPASRAKLSMINTMSKIRGQEKGPGYPQAEALLADAMLKFGRELGEDCNFGPALVDVGEA
MKELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKMEGRRLDFDYKKKRQGKLPD
EELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQATQILQRVTSKL
EDRIKEASSQPRREYQPKPRMSLDFVTGDNTQHNGGISHATTPKPSGAHMDQPCCRALYD
FEPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINYVDILVPLPH
Download sequence
Identical sequences U3JK71
XP_005060947.1.66865 ENSFALP00000003175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]