SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U3JK83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3JK83
Domain Number 1 Region: 416-587
Classification Level Classification E-value
Superfamily SPOC domain-like 2.94e-50
Family SPOC domain 0.00014
Further Details:      
 
Domain Number 2 Region: 23-177
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.49e-28
Family Canonical RBD 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U3JK83
Sequence length 589
Comment (tr|U3JK83|U3JK83_FICAL) RNA binding motif protein 15 {ECO:0000313|Ensembl:ENSFALP00000003187} KW=Complete proteome; Reference proteome OX=59894 OS=Ficedula albicollis (Collared flycatcher) (Muscicapa albicollis). GN=RBM15 OC=Ficedula.
Sequence
GGGGGAGAAAEEEISPEDDQRANRTLFLGNLDITVSESDLRRAFDRFGVITEVDIKRPGR
GQTSTYGFLKFENLDMAHRAKLAMSGKVLLRNPIKIGYGKATPTTRLWVGGLGPWVPLAA
LAREFDRFGTIRTIDYRKGDSWAYIQYESLDAAQAACTHMRGFPLGGPDRRLRVDFADTE
HRYQQPYLQPLPLPPPAHYELVAEAAAFGAHRGAPPDPLRGARDRTPPLLYRDRDRDLYP
EAEWVPPPPPVRDRGNRAAAYDPLESLERRRDGWSLERDRGERELGSSSRDQPRKRRLAE
DGGRHLDRSPDSERSSSSRKRHCLATTSPPDRSPELLGGRERYSSDPERSSRLLLLERPS
PIRESRRGSLERGQNDKRDRKNSAERERKHRAAAAQECKSPAKKDERAAEAGAAPKLCLA
WQGMLLLKNSNFPSNMHLLQGDLGVASSLLVEGATGGKVAQLKITQRLRLDQPKLDEVNR
RIKVAGPNGYAILLAVPGASDNRAAAAAAEAATTSTQRPLRNLVSYLKQKQAAGVISLPV
GGNKDKENSGVLHAFPPCDFSQQFLDSTAKALAKSEDDYLVMIIVRGAS
Download sequence
Identical sequences U3JK83
ENSFALP00000003187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]