SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U3JPA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3JPA6
Domain Number 1 Region: 24-187
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.44e-38
Family CRAL/TRIO domain 0.0027
Further Details:      
 
Domain Number 2 Region: 254-393
Classification Level Classification E-value
Superfamily PapD-like 3.4e-38
Family MSP-like 0.00000074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U3JPA6
Sequence length 456
Comment (tr|U3JPA6|U3JPA6_FICAL) Motile sperm domain containing 2 {ECO:0000313|Ensembl:ENSFALP00000004610} KW=Complete proteome; Reference proteome OX=59894 OS=Ficedula albicollis (Collared flycatcher) (Muscicapa albicollis). GN=MOSPD2 OC=Ficedula.
Sequence
MIDESFQWRKEYTVNDLSESVLPKWLFEIGALFLHGYDKEGYKLFWFKVKHHTRDPKQQL
EKKKLVAFWLEHYAKRDHGKPLTVVFDMAETGISHIDLDFVRFIVNCFTDYYPNFLTKIV
IFEMPWIMNAAFKIVKGWLGPDAISMLKFTNKSDVQEYISGEYLPPHMGGTDSFKYSYPP
LVDDDFQTPLCENGPITSEDEHESKEEIDADTKEAGDTNEAQNLNQKKMNSIEQISKTEE
TDKTEVKPKNAKKALTTFKGPLLHISPAEELYFGSKETGEKKCLIVLTNITKNVVAFKVR
TTAPEKYRVKPSNSSCEPGTSLDIIVSLHGGFAASLQDRFLIMAAEMDQSSGAGVPELTQ
FWKEVPRTKVMEHRLRCHIIESSKPSSLTLKDNAFNIPAKTNEDLHIQLTHLLQINRRLE
EQMNRCLWFQQLSVVLSLLSVTVAAFCFYLAYAQRS
Download sequence
Identical sequences U3JPA6
ENSFALP00000004610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]