SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U3JPE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3JPE3
Domain Number 1 Region: 630-909
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-81
Family Protein kinases, catalytic subunit 0.000000000666
Further Details:      
 
Domain Number 2 Region: 31-206
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.8e-72
Family Ephrin receptor ligand binding domain 0.000000444
Further Details:      
 
Domain Number 3 Region: 339-544
Classification Level Classification E-value
Superfamily Fibronectin type III 3.34e-34
Family Fibronectin type III 0.0000313
Further Details:      
 
Domain Number 4 Region: 923-997
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.55e-19
Family SAM (sterile alpha motif) domain 0.00019
Further Details:      
 
Domain Number 5 Region: 249-337
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000157
Family Growth factor receptor domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U3JPE3
Sequence length 1000
Comment (tr|U3JPE3|U3JPE3_FICAL) EPH receptor B6 {ECO:0000313|Ensembl:ENSFALP00000004647} KW=Complete proteome; Reference proteome OX=59894 OS=Ficedula albicollis (Collared flycatcher) (Muscicapa albicollis). GN=EPHB6 OC=Ficedula.
Sequence
MDSNAGISARRVSGMGWLWMVFFFHLVTSLEEILLDTTRETSEIGWTAHPSDGWDEVSVL
DDKKRLIRTFQVCNVAEPGQNNWLRTHFIERRGAHRVHVRLRFSVRDCASMRTVASSCKE
TFTLYYHQSEADTASQDMPEWREGPWTKVDTIAADESFSQVDSTGKVVKMNVKVRSFGPL
TKHGFYLAFQDSGACMSLVAVQVFFYKCPAVVKGFASFPETFAGGERTSLVESPGTCVPN
AEETSATGSSSVRLHCNGEGEWMVAIGRCTCKAGYQPVDDERACQACAPGFFKVSVGDDP
CHLCPAHSHAPLPGSRECVCQNRYYRSASDNSDAPCTGIPSAPRDLSYEIIGSNVLLTWR
LPKDLGGRKDVFFNVVCKPPPAGAAGPCVRCGDSVQFEPRQVGLTESRVQVSNLLARVHY
TFEIQAVNLVTELSSEAPHFATINVSTSQSVPSAVPMMHQVSRTTNSITLSWPQPDQPNG
IILDYQLRYFDKAEDEDNSLTLTSETNMATIPSLSPGKIYAFQVRARTAVGYGPYSGKMY
FQTLTGGERSEMVQDRLPLIVGSALGGLAFLVIAAIAILAIIFKSKRRETPYTDRLQQYI
GARGLGVKYYIDPSTYEDPNEAIREFAKEIDVSLIKIEEVIGSGEFGEVCFGRLKHPGKR
EYMVAIKTLKSGYTEEQRREFLSEASIMGQFEHPNVIHLEGVVTKSRPVMIVTEFMENGS
LDSFLRQKEGQFSVLQLVGMLRGIAAGMRYLSDMNYVHRDLAARNILVNSNLVCKVSDFG
LSRFLEDDASNPTYTGGLGCKIPIRWTAPEAIQYRKFTSSSDVWSYGIVMWEVMSYGERP
YWDMSNQDVINAIDQDYRLPPPPDCPTVLHLLMLDCWQKERVQRPKFEQIVSALDKMIRK
PSALKAIGTGTSRPSQPLLSNCPPDFPSLSNAHEWLDAIKMGRYKENFDQAGLATFDVIS
RMTLEDIQRIGITLVGHQKKILNSIQLMRVHLNQLEPVEV
Download sequence
Identical sequences U3JPE3
ENSFALP00000004647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]