SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U3JQS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3JQS8
Domain Number 1 Region: 509-805
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.74e-56
Family Protein kinases, catalytic subunit 0.0000106
Further Details:      
 
Domain Number 2 Region: 262-314
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000628
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00018
Further Details:      
 
Domain Number 3 Region: 169-176
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00000497
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U3JQS8
Sequence length 843
Comment (tr|U3JQS8|U3JQS8_FICAL) Kinase suppressor of ras 1 {ECO:0000313|Ensembl:ENSFALP00000005132} KW=Complete proteome; Reference proteome OX=59894 OS=Ficedula albicollis (Collared flycatcher) (Muscicapa albicollis). GN=KSR1 OC=Ficedula.
Sequence
LQVKLIDYIHRQRQCKLSVPLSDRTAELNSYPRFHDWLDIVNVRKEVVQRIPEELTLDAL
LEMNESKVKETMKRCGARDEECSRLNGALSCLRKVTESGWGRAEAQGDHCQVEGARRACS
ESSVPSRRAGTNAAPCDRRGAEGRCARGPARAPAPPPPPPPPPPPPPPPPPPPPPPPPPV
PGRPRTPHSITVTPPATPQPRRRHRPKPPRTPPPPCRKVFQLLPSFPTLTRSKSHESQLG
NRIDEVPPIKFELSQGSPQMVRRDFGLAVTHRFSTKSWLSQICQVCQKSMMFGVKCKYCR
LKCHNKCTKEAPACRISFLPITKIRRTESVPSDINNPVDRPTEPQFGTLPKALTKKEHPP
AINHLDSSSNPSSTTSSTPSSPAPFQSSNPPSATPPPNPSPMGQRDGRFNFPAAYYLQHR
QQFVFPVYRRLKCKRCIITVSTFPEIPSPAQTAQLPETAADTNAAQQPGTGGGAREAQVE
EPEASKSEAEDDEDEVEDLPSRRPHLPGMIYRKPSQTSVYLQEWDIPFEQIQLGDPIGQG
RWGKVYKGKWHGEVAIRLLEIDGNNQDHLKLFKKEVMNYRQTRHENVVLFMGACMNPPHL
AIITSFCKGRTLHSFVRDPKISLDINKTRQIAQEIIKGMGYLHAKGIVHKDLKSKNVFYD
NGKVVITDFGLFGISGVVQEGRLRRENELKLPHDWLCYLAPEIVREMAPGKDEDKLPFSK
AADIYAFGTVWYELQAREWPFRSQPAEALIWQIGSGQGVRQVLATASLGKEVNEILSACW
AFDLSERPSFTVLMEMLEKLPKLNRRLSHPGHFWKSADINSSKVVLRFERFGLGILEASN
PKL
Download sequence
Identical sequences U3JQS8
ENSFALP00000005132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]