SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U3JUV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3JUV5
Domain Number 1 Region: 21-249
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.45e-67
Family BAR domain 0.00042
Further Details:      
 
Domain Number 2 Region: 242-273,305-362
Classification Level Classification E-value
Superfamily SH3-domain 6.88e-18
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U3JUV5
Sequence length 363
Comment (tr|U3JUV5|U3JUV5_FICAL) SH3 domain containing GRB2 like, endophilin B1 {ECO:0000313|Ensembl:ENSFALP00000006559} KW=Complete proteome; Reference proteome OX=59894 OS=Ficedula albicollis (Collared flycatcher) (Muscicapa albicollis). GN=SH3GLB1 OC=Ficedula.
Sequence
MRIIDKQLQIELNIFNPTNLQFTEEKLGQAEKTELDAHLENLLSKAECTKLWTEKIMKQT
EVLLQPNPNARIEEFVYEKLDRKAPSRMNNPELLGQYMIDAGNEFGPGTAYGNALIKCGE
TQKRIGAADRELIQTSAINFLTPLRNFIEGDYKTITKERKLLQNKRLDLDAAKTRLKKAK
VAEARAASEQEVRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQ
YMLDLQKQLGSFPSTFLSNNNQSSTTPVQSVSSPSVLASASASLPSVSTSMVTSGLSELK
SSSGSRKARVLYDYDAANSSELSLLADEVITVYSIPGMDSDWLMGERGNQKGKVPITYLE
LLN
Download sequence
Identical sequences U3JUV5
ENSFALP00000006559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]