SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U3JUV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3JUV6
Domain Number 1 Region: 1-122,152-214
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.64e-52
Family BAR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 206-238,270-327
Classification Level Classification E-value
Superfamily SH3-domain 5.57e-18
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U3JUV6
Sequence length 328
Comment (tr|U3JUV6|U3JUV6_FICAL) SH3 domain containing GRB2 like, endophilin B1 {ECO:0000313|Ensembl:ENSFALP00000006560} KW=Complete proteome; Reference proteome OX=59894 OS=Ficedula albicollis (Collared flycatcher) (Muscicapa albicollis). GN=SH3GLB1 OC=Ficedula.
Sequence
MKQTEVLLQPNPNARIEEFVYEKLDRKAPSRMNNPELLGQYMIDAGNEFGPGTAYGNALI
KCGETQKRIGAADRELIQTSAINFLTPLRNFIEGDYKTITKERKLLQNKRLDLDAAKTRL
KKAKVAEARAAQLNTSQPEENNIMIWAEEVTKSEQEVRITQSEFDRQAEITRLLLEGISS
THAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSTFLSNNNQSSTTPVQSVSSPS
VLASASASLPSVSTSMVTSGLSELKSSSGSRKARVLYDYDAANSSELSLLADEVITVYSI
PGMDSDWLMGERGNQKGKVPITYLELLN
Download sequence
Identical sequences U3JUV6
XP_005050350.1.66865 ENSFALP00000006560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]