SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U3K1S8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3K1S8
Domain Number 1 Region: 921-990
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.23e-17
Family SAM (sterile alpha motif) domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U3K1S8
Sequence length 991
Comment (tr|U3K1S8|U3K1S8_FICAL) Polyhomeotic homolog 3 {ECO:0000313|Ensembl:ENSFALP00000008982} KW=Complete proteome; Reference proteome OX=59894 OS=Ficedula albicollis (Collared flycatcher) (Muscicapa albicollis). GN=PHC3 OC=Ficedula.
Sequence
VTPARLDKRCSAMENEPNTTTCSASTTTVTTTSTSRTPLPQISVYSGSDRHAVQVIQQAL
HRPPSSAAQYLQQMYAAQQQHLMLQTAALQQQHLSSTQFQSLATVPQASLSGGRQCTSPT
GSVTQQSSMSQTSINLSTSPTPAQIISRSQTSNTTSSSITQQTMLLGSTSPTLSASQAQM
YLRAQMLIFTPATTVAAVQSDIPVVSSSSSSSCQSAATQVQNLTLRSQKLGVLSSSQNGP
PKSSSQSQSLCPSKAASSSKGSQPDPSESNRKGESPAPECRSTPVTRTSSIHHLITPASY
SPLQPHSLVKHQQIPLHSPPPKISHHQLILQQQQQQVQPIALQTPPGQEPPPSQHCLPLP
SHALPPAPSSVPSHCSPIHIHPPPLTLSPTPSQSAQQSVVVSPPPSHSPSQSPTIIIHPQ
ALIQSQASSLVPAALQPEPAAPQAAATPVRPSQGLSLPPHLPLPPSPAVHIGAVEPPSLV
SSGQQLVSSTPHQQYPAVQSAPIPLAAPPQLSASSTQIQPLPLQSVQSLQVQPEILSQGQ
VLVQNTLVSGEELPAAEALVQLPFQTLPPPQTVAVNLQVQPSVPIETPAICQVENVCEGE
MPEDSDCVHMARTPTPPTLSPPAITLGHGEALNSEDPLSEHGGLPSVTSSVSASVIKSPS
DPSHVSIPPPPLLLPAATTRSNSTSMPNSIPSLENKPPQAIVKPQILTHVIEGFVIQEGL
EPFPVSRSSLLVEQPAEKRLLVEGQIMSVVCVESDLQNTKHADNSSDTEIEDMIAEEGLD
EIENDLLKCEFCGKMGYPNKFLRSKRFCSTSCAKRHSLSCTKKFGLFPSDKTSRWNRKSD
GQSLGRRGRRPSGPEGASRDHFLRQLPITYPSAEEDLAPHEDAVPTAMTTRLRRQSERER
ELRELRMRKMPESIDLLPVVQTDPSVWTVDEVWAFIHSLPGCQDIADEFRAQEIDGQALL
LLKEDHLMSAMNIKLGPALKICARINSLKES
Download sequence
Identical sequences U3K1S8
ENSFALP00000008982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]