SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U3K1Z3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3K1Z3
Domain Number 1 Region: 33-263
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.3e-60
Family Ecto-ART 0.000093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U3K1Z3
Sequence length 303
Comment (tr|U3K1Z3|U3K1Z3_FICAL) Mono(ADP-ribosyl)transferase {ECO:0000256|RuleBase:RU361228} KW=Complete proteome; Reference proteome OX=59894 OS=Ficedula albicollis (Collared flycatcher) (Muscicapa albicollis). GN= OC=Ficedula.
Sequence
PPPPPLLLLLLAGTPAPSARRHRRERDSDIREIALSMVPNSFDDQYQHCRLKMLRALPAL
NRSEFVLSSPYAEAWGKAAALWNSRAWPGSSQGSLLRPEQAIALLAYTMEERLYVEFNRA
VRRVGRSRREYLNNFHFKVLHFLLTGALRALRGAHSHPRCLHVFRGVDRIRFTARPGQIV
RFGQFASSSLLRNVSDFYGTTTTFEVHTCHGADIRRYSIYPEEEEVLIPPYETFNVTGVT
QQGDEVLIQLRSHGVHSKYNCAWFRGDTSTSRPKASPGRSIPRAPPGLTGLLLAALAAVT
STP
Download sequence
Identical sequences U3K1Z3
ENSFALP00000009047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]