SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U3K4K7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3K4K7
Domain Number 1 Region: 421-530
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-22
Family SH2 domain 0.001
Further Details:      
 
Domain Number 2 Region: 9-73
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000114
Family SAM (sterile alpha motif) domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U3K4K7
Sequence length 546
Comment (tr|U3K4K7|U3K4K7_FICAL) Lymphocyte cytosolic protein 2 {ECO:0000313|Ensembl:ENSFALP00000009961} KW=Complete proteome; Reference proteome OX=59894 OS=Ficedula albicollis (Collared flycatcher) (Muscicapa albicollis). GN=LCP2 OC=Ficedula.
Sequence
MDLRNVPYRSDVLTWDPDDLAEYFRTLKYKDCEKVVRKHSINGQRFLNMSENDIQKFPKL
RVPILSKLSQEINKNEGRLSFLPKWAQTQKSSDNTGTGYAQDDGGWSSFDDDDDYESPDE
DQEKEDEADYESPTEEPEEAEHDSDGYEPPPSNNDEAHHNVIFPAKSLPSSTDYIDRPST
TRSPHQPPHQPPVPPQRPGPASFGGRSATMPAFPPPPSNDLSRDRNMKPLKPPAPSIDRS
TKPSLDRLAPPYERESPGSGKKPGIPEKPLVSQLRSLGEQLAMMPKPPVPPSDRYERGNP
PPLRKQSPGKQTWPPHKKNEEEEDTALQRPVPQLSLPPYSSNAFPPKSVKPPPKPGFNSI
PVAESKEAFKSLFNSSFKQALTLFLYFSISEGSNSRSPSRGPADMRPPLPIPSRQTVHQT
NTQEDEPQGSLKEEWYVAFLSRPEAEAALRRINKDGTFLVRDSSRKTVTHPYVLMVLYRD
KVYNIQIRYQEQDHLYLLGTSLKGKEEFSSVADIIDHFQRTPLLLIDGKDRGSRNQCMLK
YAAGHF
Download sequence
Identical sequences U3K4K7
ENSFALP00000009961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]