SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U3K6V1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3K6V1
Domain Number 1 Region: 77-157
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000314
Family SAM (sterile alpha motif) domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U3K6V1
Sequence length 177
Comment (tr|U3K6V1|U3K6V1_FICAL) Sterile alpha motif domain containing 10 {ECO:0000313|Ensembl:ENSFALP00000010755} KW=Complete proteome; Reference proteome OX=59894 OS=Ficedula albicollis (Collared flycatcher) (Muscicapa albicollis). GN=SAMD10 OC=Ficedula.
Sequence
MEAAAAASAHFSFCRSLLEHTVSAENLSYRLQRNPGSSLTWHDGRSQRPDGGHAVKLLRQ
PGTEGSQVRGCDHYGIYHTSPTLGSLVKPVVLWTQQDVCKWLKKHCPHNYLIYVEAFSHH
AITGRVLLRLNGEKLQRMGIALEAQRQEVLQQVLQLQVREEVRNLQLLSQASFGNVS
Download sequence
Identical sequences U3K6V1
ENSFALP00000010755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]