SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U3K7L1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3K7L1
Domain Number 1 Region: 3256-3422
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-27
Family Laminin G-like module 0.0027
Further Details:      
 
Domain Number 2 Region: 3428-3607
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.57e-26
Family Laminin G-like module 0.002
Further Details:      
 
Domain Number 3 Region: 3036-3203
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.3e-19
Family Laminin G-like module 0.017
Further Details:      
 
Domain Number 4 Region: 2835-3029
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-17
Family Laminin G-like module 0.0081
Further Details:      
 
Domain Number 5 Region: 2641-2825
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000396
Family Laminin G-like module 0.065
Further Details:      
 
Domain Number 6 Region: 1832-1881
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000013
Family Laminin-type module 0.051
Further Details:      
 
Domain Number 7 Region: 1773-1815
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000377
Family Laminin-type module 0.0081
Further Details:      
 
Domain Number 8 Region: 1879-1934
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000502
Family Laminin-type module 0.0036
Further Details:      
 
Domain Number 9 Region: 1490-1538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000809
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 10 Region: 203-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000113
Family Laminin-type module 0.032
Further Details:      
 
Domain Number 11 Region: 445-493
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000165
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 12 Region: 262-321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.044
Further Details:      
 
Domain Number 13 Region: 1441-1492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 14 Region: 581-629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 15 Region: 1351-1399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 16 Region: 678-728
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000151
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 17 Region: 1933-1977
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000251
Family Laminin-type module 0.0043
Further Details:      
 
Domain Number 18 Region: 332-377
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000279
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 19 Region: 536-583
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000558
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 20 Region: 1980-2029
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000977
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 21 Region: 628-675
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000148
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 22 Region: 398-441
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000268
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 23 Region: 491-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000781
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 24 Region: 1733-1775
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000893
Family Laminin-type module 0.068
Further Details:      
 
Weak hits

Sequence:  U3K7L1
Domain Number - Region: 731-771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000544
Family Laminin-type module 0.077
Further Details:      
 
Domain Number - Region: 1402-1443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0363
Family Laminin-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U3K7L1
Sequence length 3615
Comment (tr|U3K7L1|U3K7L1_FICAL) Laminin subunit alpha 5 {ECO:0000313|Ensembl:ENSFALP00000011015} KW=Complete proteome; Reference proteome OX=59894 OS=Ficedula albicollis (Collared flycatcher) (Muscicapa albicollis). GN=LAMA5 OC=Ficedula.
Sequence
MQGQYCDICSSANSNKAHPITNAIDGTERWWQSPPLSRGLEFNQVNVTLDLGQLFHVAYV
LIKFANSPRPDLWVLERSTDFGLTYEPWQYFASSKRDCIEKFGQHTVDRITRDDHAICTT
EYSRIVPLENGEIVVSLVNGRPGAMNFSYSPLLRNFTKATNIRLRFLQTNTLLGHLMGKA
LRDPTVTRRYYYSIKDISIGGRCVCHGHADVCDAKDPNDPYRLQCDCQHNTCGGSCDRCC
PGYNQFPWKPATADSANECQPCNCNGHAYDCYYDPEVDRHKASRSREDKFEGGGVCIDCQ
HHTTGINCERCIPGYYRSPDHPIDSPYVCYRCNCESDFTDGTCEDLTGRCYCKPNYTGEH
CDTCAEGYLNFPHCYPVPAFSHNDTGEQVLPAGQIINCDCYAGGTEGNACRKDPRVGMCV
CKPNFQGTHCDQCAPGHYGPTCQPCQCSGPGQYDGTCDSDTGQCLCRTGFEGHSCDRCAP
GYFNYPLCQLCGCSAVGTLPGGCDSAGNCFCRAEFAGPRCEHCSPGYHSYPHCYACSCDS
RGAVDNNCSPAGQCRCHGNFAGHTCSQCALGFYGYPSCTPCQCSREGSLHGTCDQDTGQC
SCRPKVTGLRCDSCVPGAYGFPHCQVGSCNPAGLETADPSLAPGSCACRAYVEGPACDRC
KPGYWNLTPENPYGCLSCKCDTRGTINGITECRQGDGQCFCKANVCGQFCSACRDGYFNM
ENANYFGCQGCRCDVGGALGASCEERSGACRCRQSTRGPTCTQPARDHYFPDLHHLKFEL
EEGTTPAGRTVRFGYNPLEFEGFSWRGYAQMSSIQPKVVVTLNVTSPDLFRLVFRYVSRG
PASVEGGVGGGPASVEGRVSVVEEGKFNVCGNCTEQTKQIVFAPSTEPAFVTVPQNSFGE
PFVLNPNTWSLVVEAEGVLLDYLVLLPSSYYEAPILQLKVTEPCVYQPAPEQATQNCLLY
KYLSVEGFPAVPGVDAVCRLDNRLPRLCPTEQLTPSHPRMATCSGSDVEVQLSLPVAQPG
KYVLLVEYANTNALQTVGIAVSSPHSATQQGSFTFYPCVYSFLCRGIAVDSQSRTATFEL
TSETTVRFTSDLADFFLHKVYLIPAAQFTMELIEPKVHCISVHGTFSSNSSSCVPSRFLK
LSQSIILEGAQALPIAPEVPLAQAVHVAPAGVPVEPAPHPPTAMDPTAELILLQSPQAAV
VFNSRIQTLGRYAFILHFYQPSHPTFPVEVLINGGRIWQGQTNANFCPHAYGCRSLVVSE
DQIILDVTDNDLTVVVRVPEGKQLWLDYILVVPEDSYTSQYLQEEPLDKSYDFISSCGIN
SFYINPSTSSRFCRDSAISLSLFYNNGAQPCRCHEAGARGSQCQPFGGQCPCRSNVIGRE
CSRCATGYWGFPNCRPCDCGTRLCDEVTGQCICPPHTLKPECVVCEPQTFGCHPLIGCED
CNCSRPGVQELTEPGCDVDSGQCRCKPNIIGRQCDLCAPGYYHYPECRRCDCHQAGTEAS
VCDPVTGQCHCKENVEGLRCDQCRLGTFSLDATNPKGCTKCFCFGATDRCRSAEKHRAEF
VDMNGWLLLSSDRHEVPTALSPREQLITADLKNLPDAFQELYWVAPSSYLGDQVSSYGGH
LRYELHSNPRRGDVFIPMESRPDVILKGNQMSIMFLEGAYPSPGEAHEGRLQLVEGNFRH
TETHNPVSREELMMVLANLEQLQIRALFSQLSSSVSLRRVVLETATDTATGVRASNVELC
FCPANYQGDSCQECAPGYYRDTKGLFLGKCIPCHCNGHSDQCLPGSGICLNCQHNTEGDH
CERCKDGYMGSPSAQEPLQCVGCPCPLSVASNNFAVGCVHKGSNMQCLCKPGYAGPNCER
CAPGYYGNPLVIGSSCQPCDCSGNTDPNMLFSSCDPLTGACSGCMHHTAGARCQLCAPGY
YGDAVLAKNCTQCNCSPCGTDSCHPQTGQCFCKTGVTGQHCDRCEEGYYGFEGCSGCRRC
DCDVGAVGSSCHEQSGQCSCLPGVSGPRCHQCAPGYWGFGRGGCTKCECRGGSCDPRTGE
CTCPNGLTGKQCDVCLREHEILVANGPNSMKCEVCDSCVLLLLEDLQSIEMSFPSIRGQL
VTLNASSIAWARLHGLNGTIMAIANQLREYHRATSRVRQRADELEDENMDLTQDLNALQH
KMTMTHREAIRVEQHTRDMYQRGEQLLLHLQSIQRGIADLVWQMARFGAANTSATSSEEF
RQKVAEVERMLREMKERNLGAQEELARREHEEAQKLLQRVRSELHARWQSNQELLSSIQE
RLAQHSSQLMDLRDALNEAVNKTRQTEDLNSLNRNNLEETQQKSQELQKQHALVQETLQM
AQDALAQVSDFLQMMERAKEAYEKLAALLDGAKLPLTERVKKFSPASSKIPIVEQAEEHA
QLLDELARNLSGIIQDTNQDGFIQRAVDASNAYASIIEAVRKAEQAAHDADKAASQALMN
VISENLGAASRTLKRNSSSLEEAARRQQSKLNGAIKGTLQTAKDKLTDLRVKKEQLLTQL
QSVQDMLGREQEDTKDTIQNAKAAAAEANETAARVEDTLSTMKKSLDEWKDQYGGLRNED
LNQAVQDARKSVSSLESTIPLLLEKLSSLENRRNKNATVSENIVRIRQLITQARNAASKV
KVPMKFNGSSGVQVRMPSNLQDLAAYTSLKFYIQNPEPRSQQDEAQEGRFVLYLGSQEAT
GDYMGIVLKDQRVHWIYKLGDEEPTSLSVDEDIGEQFVTISINRILQYGHMSVIVERQRV
HEIKGDSVAKGEQGLLNLDPRNVVFYVGGYPSSFTPPPALRYPNYRGCLELDTLNEEVVS
LYNFQHTFELDTAAEKPCARSKSTGDPWLTDGSYFDGTGYAEIKFESQFGTTKRFEQEIR
VVSYNGIIFFLENQGQFLCLAIRDGKLALYYDFSSGLEMAKPSNSSSLTISSTTNKAIQI
FLLKMNNKKRILVRVERLTIFVVEQENSLENAVSYYLGGVPPAVLPPSLKALFPTGGPIR
GCMKGLKALGKYVDLKRMSTVGVSYGCTSDLLVARSVSVHGHGYLTLALMDVPGLQDFYS
GFSFQTSQHEGLLYHHSTQDGTCQVSLQRGQLTLSLPGSKVTTDSAYADGRAHYVAFYSD
GRGVRLYVDDELQDTRTGPGPNQRQRRQDGRRLFQLGGSPEPGAPSNLSGCISNVFVRRM
SEPQMVVDLQQNVESINVTMSCPLGEQSQQLRVTPRKDRRKPKVPGRPAPKGRRHEQDGL
CRLRPQPRAARGTFRFGGAPSSRWEFDEIPASFGFRSHFSLEVKLNSSSGLLFYVEGQQG
SSMALFVSNGRFVFLLDVGRRQLRIRSKDKYRDRRWHTVFFSRDQSRAQLVIDGLRAQGA
AVASPGLFVAQTPLYVGGLPSGKAKAHIPAASASSFDGCLRNPQLDGRPLGPPSRTFGVT
PCFEGALESGVFFATDGGSIALADAVVTEQDLEVTLEVRPRSASGLIFHIGTRRSHHLLL
YMEETKVTVRASAGADEFSASVTSPALCDGQWHTIAVTKWKNIIQVDVDTEGNHTVGPSQ
PPAPSTRATFSLGGLPETDKASTGLLFPPVPHYVGCVRNLLINQRHVDLPRAGTARGSVG
LQGCPLLSVPHPRTA
Download sequence
Identical sequences U3K7L1
ENSFALP00000011015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]