SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U4DYT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U4DYT7
Domain Number 1 Region: 1-104
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.85e-34
Family Thioltransferase 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U4DYT7
Sequence length 110
Comment (tr|U4DYT7|U4DYT7_9VIBR) Glutaredoxin {ECO:0000256|PIRNR:PIRNR005894} KW=Complete proteome OX=1238441 OS=Vibrio nigripulchritudo FTn2. GN=VIBNIFTn2_1220019 OC=Vibrionaceae; Vibrio.
Sequence
METIEKIKQQISENSILLYMKGSPKLPSCGFSSQASQALMACGEKFAYVDILQNPDIRAE
LPKYAQWPTFPQLWVEGELVGGCDIILEMFQKGELQPLIKEAAARSAEEE
Download sequence
Identical sequences U4DYT7 U4K3B2
gi|549688468|ref|YP_008620200.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]