SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U4K3B2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U4K3B2
Domain Number 1 Region: 1-104
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.85e-34
Family Thioltransferase 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U4K3B2
Sequence length 110
Comment (tr|U4K3B2|U4K3B2_9VIBR) Glutaredoxin {ECO:0000256|PIRNR:PIRNR005894} KW=Complete proteome; Reference proteome OX=28173 OS=Vibrio nigripulchritudo. GN=VIBNI_A0893 OC=Vibrionaceae; Vibrio.
Sequence
METIEKIKQQISENSILLYMKGSPKLPSCGFSSQASQALMACGEKFAYVDILQNPDIRAE
LPKYAQWPTFPQLWVEGELVGGCDIILEMFQKGELQPLIKEAAARSAEEE
Download sequence
Identical sequences U4DYT7 U4K3B2
gi|549688468|ref|YP_008620200.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]