SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U4PMG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U4PMG4
Domain Number 1 Region: 79-312
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-24
Family Nuclear receptor ligand-binding domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U4PMG4
Sequence length 321
Comment (tr|U4PMG4|U4PMG4_CAEEL) Nuclear Hormone Receptor family {ECO:0000313|EMBL:CDH93276.1} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=CELE_W01D2.2 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MNPRAVQGDTVEDPEWDEEAMPETLSISTQTDALKVKKKSHTSLFTLDIKKEQIIDNLRA
IYARTDPEEFWKLTYPGTYDFRYAFHNTKVVSPRTPLTPTAERIATLNDVVADFRRAFVL
FVDILKSIDQLRDVQEDDKMKIAKSRFAAFYWWLCSTWSAKAGCNGVCYSNGSYHPASIS
DMPKSEGKHGVRIEYVDYSGVSQKSLENLVEPLRRMELSDEERIVGAVMVILADPVPNVS
TKTEKILAEARDFYLELLGYCIKLPEEQQGIRVSTMVLLLASIMELVHLTTDNIQLSDVL
HVIDLGDWSQELRDHRYRRQF
Download sequence
Identical sequences U4PMG4
W01D2.2d NP_001293578.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]