SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U4UGA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U4UGA4
Domain Number 1 Region: 13-114
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000000000000149
Family Acetylcholinesterase-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U4UGA4
Sequence length 124
Comment (tr|U4UGA4|U4UGA4_DENPD) Uncharacterized protein {ECO:0000313|EMBL:ERL92062.1} KW=Complete proteome; Reference proteome OX=77166 OS=Dendroctonus ponderosae (Mountain pine beetle). GN=D910_09384 OC=Cucujiformia; Curculionidae; Scolytinae; Dendroctonus.
Sequence
MGDFPQELMGAGNVSHGEDQNYIFNRVMWYSQLNNADLSQFSEQDQTVHYRYLKLLVNFA
TYLDPTPEDDDLLQNIHWPVVQADNFQYLEIGTNLSVGKNPKGDRQLFWEHIFTTYGLEP
FETF
Download sequence
Identical sequences U4UGA4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]