SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U5FTY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U5FTY9
Domain Number 1 Region: 110-222,323-441,798-1007
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.96e-123
Family Calcium ATPase, transmembrane domain M 0.00066
Further Details:      
 
Domain Number 2 Region: 445-465,596-853
Classification Level Classification E-value
Superfamily HAD-like 1.9e-53
Family Meta-cation ATPase, catalytic domain P 0.00031
Further Details:      
 
Domain Number 3 Region: 454-645
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 5.56e-36
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0049
Further Details:      
 
Domain Number 4 Region: 223-321
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 3.92e-25
Family Calcium ATPase, transduction domain A 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U5FTY9
Sequence length 1013
Comment (tr|U5FTY9|U5FTY9_POPTR) Calcium-transporting ATPase {ECO:0000256|RuleBase:RU361146} KW=Complete proteome; Reference proteome OX=3694 OS=subsp. trichocarpa). GN=POPTR_0013s03760g OC=Populus.
Sequence
MTMRSRKTSDKITLDQEDLIPEPKRNQRRWRIAYTAIYFTRLLVSLSKKALVSQTKILRS
LSYVAVDVHDDTFQHENKLVSLVNVDQRTLNDIIKEKNLESLNQLGGVIQVATILETDVK
DGTREADAAFRRDVFGANRFNKPPSKSFLSFVLEACKDPTIIILLVCAIMSLVFGIKQHG
LKNGWYDGGSIIVAVVLVIAVSAISNFKQSKQFEKLSDESRDITVQVVRDGRHNHISIFD
VVAGDVVSLKIGDQIPADGLFLHGYSLKVDESSMTGESDHVEVNGSENPFLLSGTKVTDG
FGFMLVTSVGMNTAWGEMMSSISRDLDEQTPLQARLNKLTSYIGKVGLTVAILVLAVMMI
RYFTGNTRDDNGRKEYYGSKTKVSDVLDSVVSIIAAAVTIVVVAIPEGLPLAVTLTLAYS
MKKMMKDNAMVRKLSACETMGSATTICTDKTGTLTLNRMKVTEFCLGKETIEDNTEIESE
VYQLLQEGVALNTTGTVNKSHANLVPEIIGSPTEKAILSWAVMDLGMDINETKGKCEIIH
VETFNSEKKRSGVLMRKNSEKAIHTHWKGAAEMILAMCSNYYVRNGELRDLNDEEKVQFG
AIIQSMAAKSLRCIAFAHKKVVEENSQASAKLEENGMTFMGLVGLKDPCRIGVKTAVESC
KNAGVNVKMITGDNMHTARAIAIECGILNPEQDMKNGAVVEGVQFRNYSPEERMAKIDNI
LVMARSSPFDKLLMVQCLKKKGHVVAVTGDGTNDAPALKEADIGLSMGIQGTEVAKESSD
IVILDDNFTSVVTVLRWGRCVYNNIQKFIQFQLTVNVAALVINFVAAVSSGKIPLTAVQL
LWVNLIMDTLGALALATEQPTNDLMTRPPVGRSDPLITKIMWRNLLAQALYQVTILLTLQ
FKGKAIFGVDEEVKNTLIFNTFVLCQVFNEFNARKMEKMNIFKGIHKNKLFLAIIGITIT
LQVLMVELLKKFASTERLNWQQWGACIAIAVLSWPIGCLVKCIPVSCKRTQSH
Download sequence
Identical sequences U5FTY9
POPTR_0013s03760.1|PACid:18220486 XP_006375832.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]