SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U5GHR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U5GHR9
Domain Number 1 Region: 164-293
Classification Level Classification E-value
Superfamily HAD-like 2.25e-31
Family Meta-cation ATPase, catalytic domain P 0.0014
Further Details:      
 
Domain Number 2 Region: 112-185
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 0.00000019
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U5GHR9
Sequence length 323
Comment (tr|U5GHR9|U5GHR9_POPTR) Uncharacterized protein {ECO:0000313|EMBL:ERP63028.1} KW=Complete proteome; Reference proteome OX=3694 OS=subsp. trichocarpa). GN=POPTR_0003s01840g OC=Populus.
Sequence
MDLLHCQHTFCRNLGCQKTRIVILNRKISLGIVGNSQLKLKTPSIVVLVINLRRKERIRC
GSIELRIQDMICASLAAHAALATTDPSATNLSIDTCAARAYGYKIEFVVGYDVTDGTFME
EPGSGAVATIENKVVSVGTLDWIQRHGVCENPFQEVEDIKNQSVVYVGVDNTLAGLIYFE
DQIREDARHVVESLSCQGINVYMLSGDRKKNAEYVASLVGIPKEKVLSGVKPDEKKKFIS
ELQKDQNIVAMVGDGINDAAALAESHVGVAMGEGVGAASEVSSIVLMGNRLSQRYGTQVL
CFAFSYDAPSILVAAKIIALSLM
Download sequence
Identical sequences U5GHR9
XP_006385231.1.11743 POPTR_0003s01840.1|PACid:18217057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]