SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U5S343 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U5S343
Domain Number 1 Region: 14-312
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.39e-39
Family Proline iminopeptidase-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U5S343
Sequence length 321
Comment (tr|U5S343|U5S343_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:AGY78063.1} KW=Complete proteome; Reference proteome OX=1341692 OS=Clostridium autoethanogenum DSM 10061. GN=CAETHG_3862 OC=Clostridium.
Sequence
MKNKSNRLIYFEEYVHINGIDQYLFHAGTKYDNPVMLFLHGGPGFAESTLSYIFQEKWER
IFTIVHWDQRGAGKTFTKNPDKCPTIDLMLKDLFEIVQYLKIKYNKQKIILFGHSWGTIL
GSIFIKKYPDEVAYYIAVGQVISMFQNERVGYEKVKELALQSNDKKSLKELEALGDYPGN
NYGINFKKESEKLRKVQAKYGLAVNSNFSAIMGLIRSPIFRLSDISALMKMDKVNKEIVE
FWSKFDIRSESSEYKVPIYYILGKNDWQTPYIIAEEYFKKINAPYKKLYLIPGAGHMTMV
DEPNLFFDALADIRIVENVVN
Download sequence
Identical sequences D8GUE9 U5S343
gi|300854930|ref|YP_003779914.1| WP_013238409.1.13159 WP_013238409.1.37247 WP_013238409.1.41750 WP_013238409.1.46135 WP_013238409.1.69619 WP_013238409.1.91913 gi|554381620|ref|YP_008701319.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]