SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U6CQU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U6CQU2
Domain Number 1 Region: 97-268
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 5.62e-52
Family CRAL/TRIO domain 0.000028
Further Details:      
 
Domain Number 2 Region: 6-82
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 1.03e-17
Family CRAL/TRIO N-terminal domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U6CQU2
Sequence length 327
Comment (tr|U6CQU2|U6CQU2_NEOVI) Clavesin-2 {ECO:0000313|EMBL:CCP73010.1} OX=452646 OS=Neovison vison (American mink) (Mustela vison). GN=CLVS2 OC=Mustelinae; Neovison.
Sequence
MTHLQAGLSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRA
RKFHHFEAFRLLAQYFEYRQQNLDMFKSFKATDPGIKQALKDGFPGGLANLDHYGRKILV
LFAANWDQSRYTLVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSML
RLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLI
HPEILPSEFGGMLPPYDMGTWARTLLDHEYDDDSEYNVDSYSMPMKEVEKELSPKSMKRS
QSVVDPTVLKRMDKNEEENMQPLLSLD
Download sequence
Identical sequences M3YSR0 U6CQU2
ENSMPUP00000014370 ENSMPUP00000014370 XP_004740176.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]