SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U6CXQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  U6CXQ8
Domain Number - Region: 136-266
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00141
Family FCH domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U6CXQ8
Sequence length 448
Comment (tr|U6CXQ8|U6CXQ8_NEOVI) Beclin-1 {ECO:0000313|EMBL:CCP74373.1} OX=452646 OS=Neovison vison (American mink) (Mustela vison). GN=BECN1 OC=Mustelinae; Neovison.
Sequence
MEGSKTSSSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLATAQVKPGETQEEE
ANPGEEPFLETRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDL
FDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQM
ELKELALEEERLIQELEEVEKNRKMVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLE
LDDELKSVENQMRYAQMQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNE
INAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWD
NKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSE
EQWTKALKFMLTNLKWGLAWVSSQFYNK
Download sequence
Identical sequences M3YFB7 U6CXQ8
ENSMPUP00000010024 XP_004772704.1.14098 ENSMPUP00000010024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]